SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TG12|A7TG12_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TG12|A7TG12_VANPO
Domain Number 1 Region: 35-215
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.74e-42
Family Cyclophilin (peptidylprolyl isomerase) 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TG12|A7TG12_VANPO
Sequence length 317
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1028p43
Sequence
MWFKNCLFLISTFLMLNQIVAGLDYDKVYEPNPPVTHRAFMTIRYFDRSAGKTKEQEITI
DLYGTVVPKTVFNFASLGNGVKARIQGQDPDDIKVLGYKGTKFTEVVPNGMILGGDVIPE
IGPFSVHGPGFPDENFFLKHDRPGRLSMANTGPDSNNCKFFISTKVEPATELDNRNVVFG
QVVSGLEGLLDNVQNVETGAYHRPVKDVEITSSLVNELKLAEPEALHTGYVQRLEKFKGG
DKSQGITMKEMLNEGSKKKKVVKKSKKAGGKKAKTVFGIQPTQALYAIIGLAAVLVLIKL
VRKQLKNRSKNVSIRAD
Download sequence
Identical sequences A7TG12
XP_001646627.1.22633 tr|A7TG12|A7TG12_VANPO 436907.A7TG12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]