SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TG56|A7TG56_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TG56|A7TG56_VANPO
Domain Number 1 Region: 117-218
Classification Level Classification E-value
Superfamily EF-hand 1.38e-22
Family Eps15 homology domain (EH domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 7-106
Classification Level Classification E-value
Superfamily EF-hand 1.46e-20
Family Eps15 homology domain (EH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 832-876
Classification Level Classification E-value
Superfamily UBA-like 0.00000000106
Family UBA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  tr|A7TG56|A7TG56_VANPO
Domain Number - Region: 283-505
Classification Level Classification E-value
Superfamily Tropomyosin 0.0203
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TG56|A7TG56_VANPO
Sequence length 877
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1028p89
Sequence
MQSISGGSNIPSISNNDISKFSQLFDRSANGLNYLPGDKAKDIFLKANLDNATLGSIWAL
CDQNQDGTLTKPEFIMAMHLLQLTLSNNPEVNPLPSQLPQELWNSIHLPNGTSPMVTPTS
PSADVDWILPQDQKDQFDKIFDSLDKSNEGKLSSQVLVPFFLSSKLNQDTLATIWDLSDL
HNHTDFTKLEFAIAMFLIQKKNSGIPLPETLPQQLLNSPSLAIAAATPQHGIPAQPVQTQ
IPQQRVPTNTSISLPANASIQPNVNISNTVPATISRSVQPADNSTRANQELSRINEMKAS
IESKLSMLQETHKQNIAETEELESNVAVAKREVEALKQQLAMLETNNNDSNNKILELNQK
LTTSRQLNKESKDKIQYFNNMIEVSGGKLEDNKIKLKQENSMVDVNTKQLELNHNSLSTL
TSELQNMSTFLVAYLAKHKELGENQKSVENQHSQLQLKYKALDDQNKALVDKDNDLKKYT
LDIEAQEKEYHAKVDRLQSLFDDLSKKKMLFEQENELLKKKNLEYAQNIQSLSERQMKLA
MGELPDDADDVLKNAKAFSTTTDKLTTTDDGDRTESDVFDKDVPTVGSQTEGEPEDETTV
HVNAANPLNDRFDSDMTEFNIPRTQSLTSSVANNPPLSVRDDVEMPELGDPLEENVANSE
VMSETPAEWNTSQAEANGIAGTSNGADRELNLSDNINELKGISSKNGYPNIDEEFPPIRE
LDVDESDSSSDEDNNNVQTSNMGELNDEFADLELAPLEDGDADNLQSRSVPQPELSVPAP
QPVSSNPTTETAGISNDEWNQVFSGLGSSSQPDVVQGTNTLHTPTVPVIDRKLATTPKSL
AIEELCGMGFTEDEAVKALEKHNWDLDAATNFLLDNA
Download sequence
Identical sequences A7TG56
XP_001646671.1.22633 tr|A7TG56|A7TG56_VANPO 436907.A7TG56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]