SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TGN7|A7TGN7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TGN7|A7TGN7_VANPO
Domain Number 1 Region: 252-667
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-138
Family Reverse transcriptase 0.00013
Further Details:      
 
Domain Number 2 Region: 848-1006
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-37
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 88-182
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000116
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TGN7|A7TGN7_VANPO
Sequence length 1233
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1048p75
Sequence
MDVLTEGKLVRIITRYVMKEEPKDYVTAVVKLITCIRIVQKVVKPTQTIKDLKRRGLTNT
KAFPQTDRSAVQLCPIIEKSIPEIGKTSIVKATTNNTAIHVLLDTGSPTSFINHRLITKL
DLEVYKAPKFSFKGVVSEESANTTEAVEVPLKIDNKTFTIQAYVTEYIGHDVIIGYPTLQ
RFPELFDSVSTDVPVYSIISTEEVPRTINKDIYWVNTVINTSTNSSFEKLPHWLAEKYKD
TVRDDLPARDKNSNPIVFHEIELISGMKTPKSQPYRVTPKVEEEINKIVTDLIDKQFIIS
SKSPFSSPIVMVKKKDGTYRLCVDYRTLNKATVKDPFPLPRTESALAKIGAASIFTTLDL
HSGYHQIPMKREDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFSRYMADLFREMKFVNVYL
DDILIFSSSETEHWKHIDLVLQKLKNEQLIVKKPKCSFAEKEVEYLGYIISEHKIKPVQS
KCEAISKFPTPNNVKAAQRFLGMINYYRRFIPHCSTIAKPIQDYINEESTWLQPQTDAMN
ELKTILTNHPILVPFQPNGNYRLTTDASKYGIGAVLEEVTPTGNVLGVVGYYSQSLKGAQ
QNYPAGELELLGIVQALDHFKYLLHGIHFSLRTDHVSLLSLRNETEPAPRVQRHLDKLAD
YDFELSYIPGPENVVADALSRVGYNGDRPKEIVRSIAAIDGIVHIDPTTWFLDWCADPLA
GAALEALGVNADIDINSGDASAFKKYRKKFKLSTKYSELFSFKNDVLRYREQVVVPKRRR
FELLRVYHDHGIHGGHFGENVTFTKLRAEYFWPKMYHDIKSHIKYCTHCQMMKAHRLKNQ
GLLTPLDVPKGRWIDIAMDFATGLPPAFGGENMIMVVVDRFTKRAHFIAAQTPLHSSDVL
NLMFRYIFAYHGFPKTITSDRDVRFTSNIYREFTERLGIKLTMSSSNHPQTDGQSERVIQ
ILNRLLRTYAFSDHRRWAWLLPQVEFVYNSTPNRTLGMSPFEADLGYVPNAPLLKTDGEL
DARHTGGVEWTRRVKAITMRIQDALTEAQAEMEVEQNRKRRPLIFEKGEFALVHRNAYFH
AGKYKKIQPLFVGPFKVVKKIHDNAYELDLPTHVKTHRVINVHHLKKFVSRPDKYPKEAP
ITEEEILERANEVTGLVGISEDKKTYYCTMEDVDPTISVPLTEEQYNKIPLWTRTSIWKN
FKQLYLDEHPDEEGEDVVGKDGTKASLSSATTV
Download sequence
Identical sequences A7TGN7
436907.A7TGN7 tr|A7TGN7|A7TGN7_VANPO XP_001646502.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]