SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TH88|A7TH88_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TH88|A7TH88_VANPO
Domain Number - Region: 231-279
Classification Level Classification E-value
Superfamily Tropomyosin 0.0311
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TH88|A7TH88_VANPO
Sequence length 380
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1013p41
Sequence
MLDSLKGFVDDFFGKGNQDYDEDDGRKRDYGELSELRDRRKRRRAVAAKERNRMLRMKRG
DPGVADEIYSRSRGSRVQHRSLEGGVHKPRNSDSASASSAANNYNGGTRRRQYREVSPEF
VTGVPPRNNGRLRTLVNSIKSVFSNDTQELNMMQRASENLNVLVPVSPALSEREERMLIQ
DRIIRSEVFRKKLMEKRHDDVLLEQLKRGRSKTVDTPGYVSSSNLNITNDQVTLLQKKID
DMEEKITSLTKELQISKKKLKFAKEKNLLLQSLLDDANIDSEYVKSRRDIKNLQKENLIP
ETDLPPSPKRTVNPLFTSSPMRKPTIEANEDDDMNTGDIGPDEFYSKYPKIPETETLTQH
GKEKSLSPIRIDYSKYSSPR
Download sequence
Identical sequences A7TH88
XP_001646227.1.22633 tr|A7TH88|A7TH88_VANPO 436907.A7TH88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]