SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THA1|A7THA1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THA1|A7THA1_VANPO
Domain Number 1 Region: 84-145,183-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.96e-39
Family G proteins 0.00000484
Further Details:      
 
Domain Number 2 Region: 303-418
Classification Level Classification E-value
Superfamily Translation proteins 3.85e-33
Family Elongation factors 0.0000317
Further Details:      
 
Domain Number 3 Region: 419-515
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.88e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7THA1|A7THA1_VANPO
Sequence length 524
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1013p54
Sequence
MADLQDLEPSIVINGDLAPEDDIIYEEEMELDEELVVEEEEKPKKKVMFTGIDEEADEEQ
RKREFEEGGGLPEQPENPDFTKLNPLSAEIINRQATINIGTIGHVAHGKSTVVRAISGVQ
TVRFKDELERNITIKLGYANAKIYKCQNPECPEPDCYRSFKSDKEIHPKCQRPGCDGRYE
LVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHV
IILQNKVDLMREESALEHEKSILKFIRGTIADGAPIVPISAQLKYNIDAVNEFIVKTIPV
PPRDFMISPRLIVIRSFDVNKPGTEIDGLKGGVAGGSILNGVFKLGDEIEIRPGIVTKDE
KGKIQCKPIFSNIVSLFAETERFENLLFPGGLIGVGTKVDPTLCRADRLVGQVVGAKGHL
PSIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLELNEVLMVNIGSTATGARVVAVKADMA
RLQLTSPACTEVNEKIALSRRIEKHWRLIGWATIKKGSVLEPIA
Download sequence
Identical sequences A7THA1
436907.A7THA1 tr|A7THA1|A7THA1_VANPO XP_001646240.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]