SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THA8|A7THA8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THA8|A7THA8_VANPO
Domain Number 1 Region: 152-179,306-482
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-54
Family G proteins 0.00000548
Further Details:      
 
Domain Number 2 Region: 183-310
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.53e-23
Family Transducin (alpha subunit), insertion domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7THA8|A7THA8_VANPO
Sequence length 485
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1013p63
Sequence
MGLCGSKDDSTTSDSNQVNEKTRNRSNLKSGKLAKSGKDSGTTTLQHQHQQNSNNNNTTS
TTIDIKLGNINTNSNNNNKNSTNIANNHGDYKSSQLNSQSGGSTTPNDDTTTSTDLDEML
KNPNVNMSNNSDLSLTNVSTGNTEQIDVSNKNDPMAKVLLLGAGESGKSTILQQLKILHQ
NGFSDKERISYRSAIYDNLTEIGRDLIGARQKFNLQIDSNSDLTQEEIDDFLQFASEASQ
PQFESMTQYPLKYSKTLNRVWKLTSTQNLINSPDISKVYIMDSASYFMDNINRISKKNYN
PTDQDILRSRERTSGIFDTVLNLDSDLKIHIYDVGGQRSERKKWIHCFNNVTLIIFCVSL
SEYDQFLMEDRSQNRFQESLVLFDNIVNSRWFARTSVVLFLNKVDLFAEKLKRVPLENYF
PDYTGGQDINKAAKYILWRFVQLNRANLNIYPHVTQATDTSNIKLVFAAIKETILQNNLK
DSGVL
Download sequence
Identical sequences A7THA8
436907.A7THA8 tr|A7THA8|A7THA8_VANPO XP_001646247.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]