SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THB3|A7THB3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THB3|A7THB3_VANPO
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily EF-hand 1.43e-20
Family Eps15 homology domain (EH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 282-377
Classification Level Classification E-value
Superfamily EF-hand 4.12e-19
Family Eps15 homology domain (EH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 135-230
Classification Level Classification E-value
Superfamily EF-hand 2.36e-18
Family Eps15 homology domain (EH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 1194-1243
Classification Level Classification E-value
Superfamily UBA-like 0.000000000587
Family UBA domain 0.0023
Further Details:      
 
Domain Number 5 Region: 621-855
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000451
Family Tropomyosin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7THB3|A7THB3_VANPO
Sequence length 1244
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1013p69
Sequence
MLNEVVFQIGLSNEEQAFYGILFKQLDPEDLGIVTGEVLKPIFSSSGLSPQVLSQLWELV
DVNQKGFLNKHEFYAAMRLIANLQQQPSLNVSKELYSIPPSQLPRVANSQSNDLQPANTQ
QQQQQQQQQQQQQQIPSPSSNDIAKFSQLFDRSTGGSSLLSGDKAKDIFLKARLDNQSLG
EIWGLCDRNASGSLDKAEFVMAMYLIQLTLSNHPSMNPVPSVLPAQLWTAVQQSNNVNSN
FNQPQQPHVQATPLSNNSTGVSSTLGRQPTLSRVSSGAFTNAAKDWELSFEKKNQFDAIF
DSLDKSHVGSLGSQVLVPFFVSSRLNQETLANIWDLADIHNNAEFTKLEFAIAMFLIQKK
NAGVELPDVIPEQLLQSAALGLYQQSQMSLPSRESKPSFNEQPVQMTPNSQISPVQQQNT
NNSSLNDLLALNASFSSPVNQQPLADTTPSPSQNQMVPPLKKFSSTSNFGQNVIREEDEN
IEQDFHSNPFPATNIPQQVAPQRSVTDISSGQFKQSSVLPQVPPHRAPSVSLKTVPNFNS
LNISRNSTGGVLPTGSGMQTSTNTPMSRNTDLFADAAASAELSSATTELANLSNQVNSLT
KQASITTEKKSKATQELKKINDLKLTIENKLATLRATQEQNLQQSQQLENTLSSIDAENE
TLKNQAVQIETTYNACETELNQLMQSLAEGQKKNLALREEITSVNSKSALIQTQLNQKQE
EVRQTRSTIDETSKDMALSVFTASFLENEIKSLTDKLSVYLTKHNELDDYQKKIDQQQEQ
LQTKYSDLENRSGDLKIRSEQLNQRNMEIQEQENLYGQHIESLQTMFDDLNKRKVIYDEA
NENLKQQHIEYAQKVKELFDRQLKLPVEDAERLEESHAEQVSKFVEDSVANSSLGNVASR
NEDSISNDNSISDVGKEVNVTKSITDEPVSQEIENRGEIGGPIEKNVSLESQNHIPGDWE
SAKVSETKPKETSVSDTSSDEDEDNFQDTREEFFESYGDVSDSTPTVERNVEIGQPSATT
IIQDPGYINKEVDIPQVPKGASPVTQTLPVEAPLPVEAPLPVEAPLPVEAPLPVEAPLPV
EAPLPVEPTIHDEFDNAFAGLEQTAVEDPLTADSQLQPNTEEFENIEHADLEDELQRNNF
TELDNSVNPQSGNVGNDEWEDLFAGFGNAKPANRDFQQPRQDIPVQQANSLPPTPINRGV
ATTPKSLAIEELSGMGFSKEEATRALERCGYDLESATNYLLDNA
Download sequence
Identical sequences A7THB3
tr|A7THB3|A7THB3_VANPO 436907.A7THB3 XP_001646252.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]