SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THF7|A7THF7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THF7|A7THF7_VANPO
Domain Number 1 Region: 535-655
Classification Level Classification E-value
Superfamily Mannose-binding lectins 4.97e-24
Family Mannose-binding lectins 0.0043
Further Details:      
 
Domain Number 2 Region: 232-339
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000081
Family Matrix metalloproteases, catalytic domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7THF7|A7THF7_VANPO
Sequence length 658
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1039p30
Sequence
MSVTGSIEFFNLDDEAKLISPSLIIRGKCNEDKEAKTIKVEHPQLPSLEYPIHESTFRAT
VILTPGENRFTFTTNTGLQRIIKCHYTPMLQDQPVHLCLLLAKDSEYVFDSTTSQKEKEK
GHGLDLAIKKLRCGARLMQAYTNEQMLRAGFGNRTFSFVEEFAKDTLFRSQSTMRSTVKV
HLLHSDRTVEEIRDHDVAQQNRQAKRSGALYEYAMEALVKYGGPFTNSEKPVQAAVVFMD
SHWDGQFITGHAALGGGNDAIKLAIFGSHGLYSWPTCMEDIVPYFSDATTVSTKEVANDN
GQCGSHWECLTVTLGAFLHEIGHSLGCPHQEYGVMLRDYPVFNRSFLTEEAFSTRTNSNG
VASPIDPSTECKWHHLDLLRFLYHPSFTLPEDYYDPTFHRPSKIGGFVNPRPAVYPLGNE
TCKITSKEGIYSIEIFCGDLAKGYIEYLPKSLGGPGPQTEVTMTLKELQSHIPAEMIGKY
GESFGIKILAVNAPEADIGDFASLLKVKGIPMEKYGFSADVKGIKSVTFGSANAGSDTGI
IAFHPKSVKCVRIYYGQALDGMRFFLEDSNILFGSETSHFEDFELDKDEYITRFNVRSGQ
WVDAIQVVTNKGRESKMAGNVHGGGLGVLEPPEGHLIIGMHGRLQQWLQGIGIVYGEL
Download sequence
Identical sequences A7THF7
XP_001646139.1.22633 tr|A7THF7|A7THF7_VANPO 436907.A7THF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]