SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THH6|A7THH6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THH6|A7THH6_VANPO
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-80
Family G proteins 0.00000000249
Further Details:      
 
Domain Number 2 Region: 336-440
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 7.91e-44
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 241-332
Classification Level Classification E-value
Superfamily Translation proteins 2.65e-29
Family Elongation factors 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7THH6|A7THH6_VANPO
Sequence length 457
Comment Elongation factor 1-alpha OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1039p51
Sequence
MGKEKAHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL
DKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGV
GEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSVNWDESRFQEICKETANFIKKVG
YNPKTVPFVPISGWNGDNMIEPTTNAPWYKGWEKETKAGVVKGKTLLEAIDAIVQPSRPT
DKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLTEG
LPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKATESFNATVIVLNHPGQISAGYSPVLD
CHTAHIACRFDELLEKNDRRSGKKLEDSPKFLKSGDAALVKFVPSKPMCVEAFTDYPPLG
RFAVRDMRQTVAVGVIKSVVKTDKAGKVTKAAQKATK
Download sequence
Identical sequences A7THH6
tr|A7THH6|A7THH6_VANPO XP_001646158.1.22633 436907.A7THH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]