SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THL6|A7THL6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THL6|A7THL6_VANPO
Domain Number 1 Region: 4-218
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.09e-51
Family Thiamin pyrophosphokinase, catalytic domain 0.000000512
Further Details:      
 
Domain Number 2 Region: 223-310
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 1.22e-23
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7THL6|A7THL6_VANPO
Sequence length 317
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_543p11
Sequence
MSETCVENDDRFEVNCDGINIIRTLSVESMLKPVSTVDSALLILNQEIAIGPLFLKLWSQ
YDLIVCADGGANRLFNYFKEDELQRQKYIPDYIIGDFDSLDLDVKHYYQNAGVVTIKQSS
QYSTDFTKCAHLISLHFNLPDFKLMLKSSDVSENHGIEGEKGIHTLYYQMKEQHDSKQFN
KISLLALGGIDGRFDQTIHSITQFYTLEKSDPYIDLYYLTPTDIIFMVQAGGILLTYPTL
FRDTCIGNCGVLPIAAPSEIIESRGLKWDVSNWKTSITTGQVSSSNRFAGFNKCYINVKE
NVIMNIEIKLQNLTNNI
Download sequence
Identical sequences A7THL6
XP_001646040.1.22633 tr|A7THL6|A7THL6_VANPO 436907.A7THL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]