SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THP4|A7THP4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THP4|A7THP4_VANPO
Domain Number 1 Region: 10-76
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-26
Family Chaperone J-domain 0.00037
Further Details:      
 
Domain Number 2 Region: 269-357
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000994
Family HSP40/DnaJ peptide-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 108-141,220-261
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000275
Family HSP40/DnaJ peptide-binding domain 0.0051
Further Details:      
 
Domain Number 4 Region: 123-215
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000000000288
Family DnaJ/Hsp40 cysteine-rich domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7THP4|A7THP4_VANPO
Sequence length 414
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_543p40
Sequence
MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI
TAAYQTLSDEDKRNEYDNKKNFEPYFESDFANNHDGNYNSRYRSRSKDIKVELSLKTSEL
YNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFY
TTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKG
EADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFD
DRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDII
KIRNILPNEKTKRNNIVDPINSEYISTFEIVKSLPQEEGEEQTEHDTNPSCAQM
Download sequence
Identical sequences A7THP4
tr|A7THP4|A7THP4_VANPO XP_001646068.1.22633 436907.A7THP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]