SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7THU1|A7THU1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7THU1|A7THU1_VANPO
Domain Number 1 Region: 708-1151
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.23e-84
Family Reverse transcriptase 0.00023
Further Details:      
 
Domain Number 2 Region: 1331-1471
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.18e-25
Family Retroviral integrase, catalytic domain 0.008
Further Details:      
 
Weak hits

Sequence:  tr|A7THU1|A7THU1_VANPO
Domain Number - Region: 157-240
Classification Level Classification E-value
Superfamily XCC0632-like 0.0523
Family NLBH-like 0.0046
Further Details:      
 
Domain Number - Region: 565-666
Classification Level Classification E-value
Superfamily Acid proteases 0.0875
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7THU1|A7THU1_VANPO
Sequence length 1665
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1031p7
Sequence
MPGDKMEKAMKALQESIEAMNAKMDTNLEVINKRMDSNYDLINRKMEEKQEEHINYREQF
QQSLNALKLMNNDLTNKLLELKTKDDEERKALYDASIEFNSFQQEQEKLKKKAKELGVEL
KQEREQAEAVFNLEEQALNTKFEQEDKELSNITKGITDDLPLYLQNFKGELINEVQTLIA
QQEQPTQDKTAINEKQKEKLLLTKIRKHSPLIIMDEQHRIAAACNKSFVDVTLIPTTSMV
VENIYTKDNTAAILEIQQALINKRVQYSDWSMFLSLCCKSSAAHHLRDARGNIMSWKDCI
LSIYKYFNFQKSASQAEDELVNRQITDGENVTMFMLQLTEMANAKRSTNLFPILLRKLKL
IMRQQFPTIKIPNFSDFSNYEDVVGYINEFLPEDQIYTNSNTQTTNLFALQNYQNKNRNI
AKKILFYCTNCTCNKCRNINSYQNKKPGFCLNCSCTKCNNTKTKYYQNKRTNNGSLTNKK
YNINEIQIANNNEENPYHEQNDSDYSRQFTTIEINEETDSDEEQDINNEILDSYIESYSD
NTQNDAEPSVQVNSLQLNNTEINHFNDKQPNLIFDTGADANFIYQPILQTHQHKLHNLII
TIIDTIHCTPILIKPAIGNTYIIDKIARVKIQTNNFHIEEKFFIIPEQRTNIIFGKPLLK
LLKYQLQENHESIEINGTRVIIPTVNPLLNNQPHIRLIKQTEIKEQLRQQYPLVFAEATL
NTKKTKHNYIAFVRLNNFPYHKPKAYFTNQLQRQAIQQFITQSLESHMISPIATDELVAL
SPVFPIQQSKDKIRIITDLRKVNNHLQYTPRPIPPIQHIFSNLANKTIFSSLDIRKAYQQ
IPIKGDKLGLITEFGSYKFNRLPYGLASAPYWWGEFIQNLLKQLPTSKNTTVSYYYDDLV
IASLTIADHYSTLQNIMRLLSDHGLSLSYEKIHIAESKIHFLGYEISHNRLAIDKDKKNT
IAQWELPQDKKAIEKFTGFVNFLRNFIPNASKLLQPFYQFATGKTPTQHINTTKSAMTTN
FHLIKQAILKSITLKLFDPQAPTIIYTDASLTGAASILLQPENQNGNTILYPIAFYSIRF
NPTQQRYSTVERELWAVLHTLEKARLLLSSNITIYTDNQGIISIGKTERATHPRLTKYLD
LLNTYRLTWKYIKGSQNYVADYLSRYGLSQKTTLNLDEWEQLGTTIDLATTQLNNLTNEP
SANDTDLIINNVHNLSWSQILEIQQILRENLPVPQIYQNIIHIFTWVNNNFYIFYHQQLH
HILTDIDYIQKATSAHNRFHASHRVLEQIMVQEKYWNPKHSVLLLDIVRNCQHCETYQRF
IDLPVELPKMKVTPPLTRWHFDFAGPLPSSNDYQYFILAVDYTSNITVTKPIKSPNSYAV
TDIILQIYALFGKPHAIITDNAQSFISDLIQREVKRLHLNYYQSSVYNPRGNSKAERTIK
MIKTVLKHLEPNLVNWPANLYNATNIVNNTKMIYGYAPCEIAFAKQAHIPKKQHSWLPLQ
ESQSSISIDATSQFQQEEQVQIALFNHKLLHEARKITKDERTKIREMLHRVRKDKQNEME
FIVGDPVYRLRKKNKMHEPTWDGPFYISQQVGQHTYKIRTKNGIEKKYTYHSTKLRPAYS
EQGSAIRTAAEYTRVYNDQERDYYIKTLDDIIKDKAYNSSTPRVL
Download sequence
Identical sequences A7THU1
XP_001645961.1.22633 tr|A7THU1|A7THU1_VANPO 436907.A7THU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]