SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TI29|A7TI29_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TI29|A7TI29_VANPO
Domain Number 1 Region: 2399-2519,2549-2690
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-74
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0018
Further Details:      
 
Weak hits

Sequence:  tr|A7TI29|A7TI29_VANPO
Domain Number - Region: 2178-2260
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.051
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TI29|A7TI29_VANPO
Sequence length 2767
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1045p22
Sequence
MNSSILHSINNGLCSTKIKDHNNAIDELISILKQNPGIVEGKILTEINVSLVQLLAAEHH
GHCTLLESQTETSQSKLTTSENRLSSVSYALRLLIEKTSSKLKLKSLRLLLFTLPKLMLQ
KGTKSLLDAVSVHLSYGLLALVRSEPFQLKFMQDEWVEVVNILCSYIDERVKKSNINDRN
VTNFLLVLDTLVSMDTTGLEHVSVDLNKTIINYLEKCSEENAITIILIKLINQLVVRTHC
MNINATLTLISETWRYYIRIGSLNNEDTQLEFNFFDFMSSNLVHNELPVMIGNDENQKNV
IYGILKEYIILRSVRYKANSLLLSQIDLSENVVLNPSLFAIGNIRLKRNGDIVPWVELLS
LTKVLITFFKLKLLEEDNGLLFKKRKLEPSITSYLLNSTNIESFILQLIASESNDIQLIG
LQISVFFLSVEDSEKGFLNEMTAKVIKKFENNELIGWASLVLTCILSQYHHTLTDLDVTK
ILKVSIPLIKIDEFCSIACLLVAFCIKYSAFSVTDQSVSAQIQDVYELSDINGPVQINNI
TFIFWTYFEQYGKRLQTYGYSLKRVLEWLNSKWEQLNELHEENSKISDFVGWICGQNSSR
SINFFSDSAMTTLKVAHWNRLTYIWDTLSIQRRHLIALKDVPRKKKLPLQMPHPNQFSVN
KTNVVNDFLNRFIDQVESNKNTDLDRYQWIFQCTLYISCFINEVIFADLVPVLTSTIISV
LPSLKLTSDSHYCIIFKGILTSNCLSHEYQLLPSSEVIKLLDDYKMHLKRNKKTNSNVIY
ELQYMYIENEINDDILSNEHVLKRYDSDTLILSFQVLLRCADISNNGTRREFLLYLIEYL
AELSNNELINVLNSILLSLSKYLVENMDILEKLIDIIANNLLNDKYGNTSSSVYLLCEFL
DSCRQIWLSKRNTKVTEDCNDFFDFLFQTFDSNTFSGTFSIIKYSNFLLNLLLYGNYTAG
EVLHGRRKQIFKTMMDCLKRVNDALVTKMVPNLSRYISGIRPENQAIALIELLELYEQPQ
QSLEKSAFFSLSIELLSMYSFSNLLFGIQRMQVCATYPHTRKYIKFALINISQRYNLSDL
NSLFAMCKFEILNLWISKMPSASNFSDFDIELFDFDDIKHFLNLYQTEIGAIIYSDSKDY
QKLKENLILVTNTSERSLMTKCINCAIALSYVEGNIQGQIHKLVYDILPQSFSKTLKSQY
FIRLRWFLNFVDLGVPKQVSMILYNEFPKSFLLSHLFENGSSMQYKMAISIPLINFKQIL
NDECFYKVQDVGELKIVIFWILSDLEKSISEQHSINCIRELKLLLVMFENIVLQSSASIT
IIERLSIYISQSHLHEESISVITELLRNAYAMKYDITSILVTVFSQVLTYLNDGKNEASY
LVKELLQEMEGWDIEYSTIWEYCRFVIYGNKKEIQIVQSIDILEISQCGKSGLTLLSILF
SYSKLNPIQFSPLKDNVANIIKADIPKHLLTKQFQLWVVNCLTEYYLRNQRWDDIIEKEK
YEDYKQIFAQLGSLDHFYSLFFSYKNIENSNMGNHSFLISECIQNVLIYEYENSENRFWT
INNELYSKFKVSKFSINIDSYSVIIGGKDKIISLEHFISNNFFLEVIKYEEWISNFTSSL
LYHIASYVPHMVIFKELCCNEIKFSETVISTLIYIAVYVDARSGVKWVSSLLSSLDRILL
TIDSKKKLNIMFNIFRMVRTGNRTGEQYCFSIYENIDIPLIYMTAIRSGFTSLGYMLLEE
HCMFPDRDLDVKNLKTVYETLNDIDLMAGLPIPHTLAGAIQNINKTCPSAWKRFLFNNAL
YDSTVHHNTQENIYPLIKSTEDNGFFSMTASLSKNLEFENLENSYNWALELGNWELPEPS
HISDKISGFYYSLKRLNYESGNPVGNLDNSLIKLVDVKSNFINKSEWMDTIVELSLLKKI
LLDTSAGSCMSTLKFYSNLDRNQIHYLNHENYDSNLKVRYLVSSILTKISYRNNNSSICK
QLELTSLFFLSNLIKFSIEEENTQMALQNSILLDDLVKVSKYATKNIEYTKTMHVAKALW
ALDERKTAIMMMRDLKEETRVNVNPKVNDSYEYLFDVSTNEINATLVKWTSQSRYESAKD
ISETYVNDIKLSKEESNSQTEVFYILGEFFDEQINKLNEDDYISELQNRCQNALNELQTL
KAIASKKNLKSFERKDAERQYSRVHIQYKKDKELLDNLKSQYERFLENALKNYINVLTYT
TKYDNDVLDKFCGLWFSYDSDEKVNTLLLEEIQKVPSWKFLPWVNQIASKLSMDNSSFQK
VLQHTMTRLLYNLPYDSLYAILSISFYKMQTKNMDESIVQKVKAAENILNELKSYDNGTY
YRKIVEPIQEFCEKSILLSNTKLQRSSKVYLKSLETGKYWLQTLPSQSLPLPTVKFETSK
ISNGGLDRPYITSLKETIEVTSTGLSLPKILTFYLSDGTRHKVLLKGSNDDLRQDAIMEQ
VFKQVNKILRGDSEIRKHDLSIRTYEVIPLGPRAGIIGFVSNSVTLHAILKEKHKHDEIQ
FDQARELMGNVQTKSNKERLEVYQKIARKIKPQLRNFFFDSFTEPEEWLNAKRKYTKGTA
VISIIGYILGLGDRHLNNILIDYVTGEPIHIDLGIAFDQGRLLSIPETVPFRLTRDIVDG
FGVTGVEGMFRRSCETIYGVLRKDRDKVLHVINILKWDPLYSWVMSPVRKHKHLIEENGE
LINNISFSENSNSKMLDENQEANRAIKGVEEKLRSRLSIEATVQEVIQEASDPANLSLIF
KGWSPFY
Download sequence
Identical sequences A7TI29
tr|A7TI29|A7TI29_VANPO XP_001645894.1.22633 436907.A7TI29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]