SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TI82|A7TI82_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TI82|A7TI82_VANPO
Domain Number 1 Region: 24-481
Classification Level Classification E-value
Superfamily L-aspartase-like 3.77e-155
Family L-aspartase/fumarase 0.000000000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TI82|A7TI82_VANPO
Sequence length 485
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1045p76
Sequence
MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE
RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS
GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH
LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ
QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG
ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ
VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS
ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM
LGPSS
Download sequence
Identical sequences A7TI82
436907.A7TI82 XP_001645947.1.22633 tr|A7TI82|A7TI82_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]