SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TIB1|A7TIB1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TIB1|A7TIB1_VANPO
Domain Number 1 Region: 452-731
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000000129
Family Exostosin 0.041
Further Details:      
 
Weak hits

Sequence:  tr|A7TIB1|A7TIB1_VANPO
Domain Number - Region: 679-839
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00101
Family Calcium ATPase, transmembrane domain M 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TIB1|A7TIB1_VANPO
Sequence length 1033
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1054p24
Sequence
MGNKQHIEEHAYRSTVENALEDYHEQPEHYLDYIHEPSRPQPIQYQALNYSGQTHGANIQ
HQSQELPNHNEGQFIDNDRHAFQQQWDQRQFEVPTYGSNANYDDGYNREQNNNFTHQAKY
EDDYKSEHFVFDSTSKSYELADEGTGSIIEANGEDNYNISTYYDDNDQMIDPYYDSGQRY
YPNYNNNYPYIIRDNFDEENDLSNSIINGYLKNYDDEEGMDDMNTLDKLRFDTDDHTISD
VSSAETRVSAKASPKINKAVGISRASTVLRKFKLWNGNFIFDSPISKYLLEKYSIAATEN
QNLLSNEFKFMRYQAITCEPDKLAEQNFTVRQLKYFKGRETELMIVITMYNEDHILLGRT
LKGVMENIKRMVRKKNSNTWGPDAWKKIVVCIVSDGRSKINEKALSLLSSLGCYQDGFAK
DEVNDKKVKMHAYEHTTMMNITEVSEKDIKLECNQNTVPVQLLFCLKEQNQKKINSHRWA
FEGFAELLQPNVVTLLDAGTMPGPDSIYQLWREFRNPQVGGACGEIKTDIGRFGKNLLNP
LVASQNFEYKMSNILDKTTESNFGFISVLPGAFSAYRFYAVKGQPLEKYFHGEHMEGDQK
NFHFFSSNMYLAEDRILCFEIVTKKNSNWILKYCKESYASTDVPSRVPEFILQRRRWLNG
SFFASIYSFCHFYKIWSSGHSIFRKLILNFEFFYLFFNTLMSWFSLSSFFLVFRILTVSL
SLQYQSVFNILSVVFLWLYGICILSTFILSLGNKPRSTEIFYVTTFVIFAVLMGYMIFCT
VFLTVKAFESILLDHSFTVKSLLTSDTFRDIVISIGSTYALYLISSIIYLQPWHMVTSFA
QYILLSPSYINVLNIYAFCNVHDLSWGTKGAVAKPLGKINTQADGTFDMEILISSEEIQL
NYEKHFENLNKPTANEEVEETINYEERKTGYYGNIRSIIIIVWIMTNFAVVAAVLETGGI
DQYISMRHNKKSNEITEKLLPIQSSYYFNIILWIVAFLALVRFFGCSLYLISRPFKKLWF
KRTARNSPPASSV
Download sequence
Identical sequences A7TIB1
436907.A7TIB1 XP_001645835.1.22633 tr|A7TIB1|A7TIB1_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]