SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TIT5|A7TIT5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TIT5|A7TIT5_VANPO
Domain Number 1 Region: 915-1039
Classification Level Classification E-value
Superfamily CheY-like 3.13e-32
Family CheY-related 0.0000501
Further Details:      
 
Domain Number 2 Region: 727-832
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.03e-25
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 3 Region: 499-573
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000124
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 4 Region: 567-661
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000013
Family Histidine kinase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TIT5|A7TIT5_VANPO
Sequence length 1042
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p68
Sequence
MLRACNVSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIA
ARLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSV
VFLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLN
DSTYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTN
TNGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAI
GYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPI
VRLQKATEVISKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEKYTEIG
KANKSTESLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDA
LDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAME
ETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFG
KISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLG
EYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNKSVASDTERST
NNTIYSNKFKNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQG
DQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNEL
VFEDEFNINSKKNREVKFQEITDEVDQVNIEGNSGVEVEPGKCTEPKKSTESESQAVVPS
KSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEI
QSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDG
FLAKPIKREQLKGILTEFCPKA
Download sequence
Identical sequences A7TIT5
436907.A7TIT5 XP_001645735.1.22633 tr|A7TIT5|A7TIT5_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]