SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TIX5|A7TIX5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TIX5|A7TIX5_VANPO
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 5.75e-18
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TIX5|A7TIX5_VANPO
Sequence length 586
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_541p30
Sequence
MVLINGVKYACERCIRGHRVTTCTHTDQPLMMIKPKGRPSTTCDLCKELRKNKKALINSP
NAICTCGRLEKKRQQQKLKEEAKAKAKALAKEQKREKSRNGLISSSERKKKINSSNASSI
SNLSNMIKAEGRLSELSLLSGNGMLPTQHSFTNIHPNSSGYAFSDVSSTNSPPSSIDGRS
NYGTNPIAMSRNISESSNFLPNASSFLDSGHNIASPTSGKITKDYHRVASIASLSSLHSQ
QSLEQSFSPQSPIHNSLNFVGGSSLNSNTISTNPLYASNNSESHINLSDLTSKQNLQRSK
NELSISLDEFLPGDMDNSSPNWLNDTSLNNANIQSLNNSLNQVNQRQNHNNSLIHNNSYN
SANSQSLDSGLLDTFMDPSSISGISKATYLLQDNNNKNGTDSKNDILNYFNETLNIGNNN
MSKGQEILQGRGDLNDLSPDSNIVKNELDDLRSLNSVEVISLAPGSLDIPDPSFSSTFFD
NRQDTQNSLPFNATSKESTNVNNNPVISLSEKQSMHQPTSPDALFSNLNESINYPSQSNS
ISYGNLKSNNNFNNTNSPYDTNIQTDLDQILLQTTIPTETDDLLNI
Download sequence
Identical sequences A7TIX5
XP_001645645.1.22633 436907.A7TIX5 tr|A7TIX5|A7TIX5_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]