SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TIY1|A7TIY1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TIY1|A7TIY1_VANPO
Domain Number 1 Region: 38-152,271-364,722-930
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.58e-123
Family Calcium ATPase, transmembrane domain M 0.0000634
Further Details:      
 
Domain Number 2 Region: 368-388,524-775
Classification Level Classification E-value
Superfamily HAD-like 2.39e-58
Family Meta-cation ATPase, catalytic domain P 0.0000806
Further Details:      
 
Domain Number 3 Region: 379-576
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.87e-46
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00044
Further Details:      
 
Domain Number 4 Region: 151-270
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.89e-27
Family Calcium ATPase, transduction domain A 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TIY1|A7TIY1_VANPO
Sequence length 944
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_541p36
Sequence
MSENPFESTLAGSNELLESENLLSATSEVLNLPNPSLEFCTLSTAETLERLGTDPITGLN
SIEEVSRRKVEYGANEVSVEDDESLIKKFFMNFLEDPLILLLMGSAVISFLMGNIDDAIS
ITMAIVIVVTVGFVQEYRSEKSLEALNKLVPAECHLIRGGQESRILASGLVPGDLVHFRI
GDRIPADIRIIEQVDLSIDESNLTGENEPVHKSARRVNKESFNDQPNCFIPLSNRTSIAY
MGTLVREGHGKGIVIGTGTNTCFGAVFEMMSSIEKPKTPLQLAMDKLGKDLSFMSFIVIG
VICLIGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV
ETLGSVNVICSDKTGTLTTNHMTVSKIWCLGSMSNKSNVLSIEKNKNGNLKNYLTEDVRQ
TLMISNICNNASFSHEHGKYLGNPTDIALVEQLSKFEMTDIRQNLKKLKEIPFNSKRKFM
ATKIIDSEKKCGIYVKGAYEKVLENSVFYLNKNGKPEKLTDQLKEVITDCANDLASDGLR
VLAFAKVDVDNEKAELNESEISGLVFTGLIGMNDPPRATVKPAIEQLLQGGVHIIMITGD
SENTAVNIAKQIGIPIVSKDVSVLTGDKLNDMTDDQLANVIDHVNIFARATPEHKLNIVR
ALRKRGDIVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIE
EGKGIFNNIQNFLTFQLSTSVAALSLIALSTAFKLPNPLNAMQILWINILMDGPPAQSLG
VEPVDNDVMKKPPRKRSDKILTPFVLRRLLTTAVFIIMGTVYVFMKEMAEDGKVTARDTT
MTFTCFVFFDMFNALACRHSTKSIFEIGLFSNKMFNYAVGFSLLGQMCAIYVPFFQNIFK
TESLAFFDLVFLFFVSSSVFIADEVRKYYSKKQELEDPYYYSNV
Download sequence
Identical sequences A7TIY1
436907.A7TIY1 tr|A7TIY1|A7TIY1_VANPO XP_001645651.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]