SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJ02|A7TJ02_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJ02|A7TJ02_VANPO
Domain Number 1 Region: 214-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.67e-91
Family Leukotriene A4 hydrolase catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 7-203
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.63e-55
Family Leukotriene A4 hydrolase N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJ02|A7TJ02_VANPO
Sequence length 859
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1033p4
Sequence
MSSSIEREVLPSNVQPLHYDLEVEPDFETFKYSGNVKIDLKVKDKTIDNVKLNVVDIDVH
SAKIGSSDAKTISIDEDKQILSLDFEDGVVSKNDQVQLEISFTGNLNSNMAGFYRAKYED
KLTGETKYMATTQMEPTDARRAFPCFDEPNLKSTFDVTLISSPIYTHLSNMDVKSEIEQD
GKKITKFNTTPNMSTYLVAFIIAELKYVENKDFRIPVRVYATPGNEKDGQFAADLTAKTL
AFFEKSFGIQYPLPKMDNVAVHEFSAGAMENWGLVTYRVVDLLLDKENATLDRIQRVAEV
VQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFEPEWNVWQQYVTDTLQHALS
LDALRSSHPIEVPVKRADEINQIFDAISYSKGASLLRMVSKWLGEDVFIKGVSEYLKKFK
YSNAQTEDLWTALSEASGKNVSEVMNTWTKKVGFPVVSVNEDGNKVTFTQHRYLSTGDVK
PEEDETLYPVFLSLKTKEGVDSSLTLNERSKTIELKDSEFYKVNSDQSAIYITSYSNDRW
NKFGKQSHLLSIEDRTGLVADAKALSSSGYTPTTNFLKLVSDWKQEKSFVVWDQIINSIS
SMKAAWSFEPKEVRDALENFTMHLASEKAKSLGWDFTTKESFADQRLKVALFGAACDSKD
QVIEKAALEMFAQYSAGDEKAIPALIKPSVFNAAARVGGVENYEKLFKIYNNPMSSDEKL
AALRALGRFSDPQLLERTLGYLFDGTVLNQDIYIPMQGMRTHKEGIEALWGWMQTNWDEL
AKRLPPGLSMLGSVVVIGTSGFTSLEKVKEVNEFFDKRSTKGFDQSLAQSLDTITSKAQW
VNRDRGVVLAYLKENGYYK
Download sequence
Identical sequences A7TJ02
XP_001645559.1.22633 tr|A7TJ02|A7TJ02_VANPO 436907.A7TJ02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]