SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJ15|A7TJ15_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJ15|A7TJ15_VANPO
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.57e-65
Family Dehydroquinate synthase, DHQS 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJ15|A7TJ15_VANPO
Sequence length 269
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1033p17
Sequence
MVPLEKIPILGKDTIHVGFNIKQHMIDTIINDCKSSTYVIINDTNVAKVPYFQEFVEGFE
LSLPEESRLLKYAVNPGEQNKTRETKERIEDYLLTQGCTRDTVVIAIGGGVIGDMIGFVA
STFMRGVRVVQIPTSLLSMVDSSIGGKTAVDTPLGKNFIGAFWQPSFVLVDIKWLESLPK
REFINGMAEVIKTACIWNASEFDRLESNADTFLDIVNNAKIIQVSNKVTGTVDHISNTNV
ELMLEHTYKLVLESIRVKAEVVSADERES
Download sequence
Identical sequences A7TJ15
436907.A7TJ15 tr|A7TJ15|A7TJ15_VANPO XP_001645572.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]