SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJ40|A7TJ40_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TJ40|A7TJ40_VANPO
Domain Number - Region: 149-251
Classification Level Classification E-value
Superfamily Tropomyosin 0.00425
Family Tropomyosin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJ40|A7TJ40_VANPO
Sequence length 281
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1033p45
Sequence
MDSDKSSSSIILDIAWSELDNGDQGFIYAKDFPNFIHIIENIIYKSQDSNERALLSETGK
GVISTFAKEKAFFKIYKDEFKEIFHGLIGKSFNESLKGTFKSGNIQTDMCPEKGLENPEI
MGKNKPSNSNAFNSIQDNAKSSVLESPRKLNRKLKGLENQISLANDELKFKDNIIIEKDR
EIIQLTRSLGEYKDKYEFLQREFSFYKDRGEFNKKYQDMNNINQAQNMDDIIMDHTKHEF
IISELKRKLQDQLETIGALREELHGDSNTTKRSFYYPVYSN
Download sequence
Identical sequences A7TJ40
tr|A7TJ40|A7TJ40_VANPO 436907.A7TJ40 XP_001645597.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]