SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJ63|A7TJ63_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJ63|A7TJ63_VANPO
Domain Number 1 Region: 509-580,612-656
Classification Level Classification E-value
Superfamily CheY-like 4.74e-27
Family CheY-related 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJ63|A7TJ63_VANPO
Sequence length 714
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1004p4
Sequence
MFELSERRKALSPLPRGGNLALNVALDWKIWVKIDDNERLGNSKGQATAIEFTESDTIDD
LKTKLLTKLNNSRWSRENDTCSITIGFYLPIKNSKVTNNNNINNNANTSLLSIESNQRIH
TERKKVSPGLHFYMEAPLSRMDSHNGLHYENSSKNRSSVSLQSLRQAESNNIKNESHSIN
STSPPLIFHSSSNINLQYLAPTPTLGRLSPINTSQSTNYLDFNNLDLKWTSIRVNDSNVR
ITFEPDELIKNIYLQLYGSLGAQKVSEALLIFSSGIPTNENNEISPTVSFDFNDYVPTND
EITEQMLRSPYYGENLMENEKTEGFKGEEGLIKDGSRFGSCDSVTQSLSGKEKKFKLITN
EEQLRKVSEDLGSEKNVDSPKQAILLLPKNFNEENNLRNKTGGGSSSTISSFVNKTNDEI
MLSTQEGTASTNDSGISDGGVEPRESISNSSTNTNSNTIHNNDNSNPIISSSAMIAKSTS
SNYSSAFQDASVPIVSHPEFKITGEKVFPKINVLIVEDNVINQTILASFLRKHKISYKVA
KNGREAVDKWKEGGLHLIFMDLQLPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLE
DTKKIDKNSTGAPVIIVAFTASNSLTDKREALISGCNDYLTKPVNLHWLSKKITEWGCMQ
GLIDFDNWKQGQSRMTDSVLVKQTPKLTKRKSSSKSPLASTSSSPKISAPQSKN
Download sequence
Identical sequences A7TJ63
XP_001645490.1.22633 tr|A7TJ63|A7TJ63_VANPO 436907.A7TJ63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]