SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJ77|A7TJ77_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJ77|A7TJ77_VANPO
Domain Number 1 Region: 572-974
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.67e-126
Family DNA polymerase I 0.00000396
Further Details:      
 
Domain Number 2 Region: 132-551
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-101
Family DnaQ-like 3'-5' exonuclease 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJ77|A7TJ77_VANPO
Sequence length 1096
Comment DNA polymerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1004p20
Sequence
MSIGLKRPGEDESSELQDGTIDKKVRLQSKDHGVGSEPVSTIEIIPTDSFRKFKEHGYKA
KGSDIHGTQMVSTFEQELSQMEHEIAELDEQSTESYPRKPLDPEFSPETHDISFQQLDCE
DSLLPGSKDGSTSYVVRFFGVTDNGHSVLCNVTGFKHYLYVPAPMSAESPSNEDLLGFVK
HINEQLDNCVDSIEIVEKQSIWGYSGDSKLPFWKVYLKTPNMINKVRTGFEKGHFSYKSW
FSNGTTSYDNIAYTLRLMIDCGIVGMSWITLPKQKYKMIPEKDKVSTCQLEVKINYKDLI
SHAPENNWSHSAPLRILSFDIECAGRVGVFPEPEHDSVIQIANVVSIAGAKKPFIRNVFT
VDTCSPITGSHIFSHETEKEMLSKWREFIVKVDPDLIIGYNSANFDLPYLIDRAKALKID
NFPYFGRLFNVKQEVKESSFSSKAYGTRTSKVVNIDGRLQLDLLQFIQREYKLRSYTLNA
VSAHFLGEQKEDVHHSIITDLQNGDSETRRRLAVYCLKDAYLPLRLLENLMALVNYTEMS
RVTGVPFSYLLSRGQQIKVVSQLFRKCIEIDTVIPNMASQGTDQQYEGATVIEPIRGYYD
IPIATLDFNSLYPSIMMAHNLCYTTLCNKETVQRLNLKKDEDYIITPNGDYFVSTKLRHG
ILPIILRELIDARKRAKKDLKNETDPFKKNVLNGRQLALKISANSVYGFTGATVGKLPCL
AISSSVTAFGRDMIMTTKNAVEEKYRISNGYKHDAVVVYGDTDSVMVKFGTSDLKESMEL
GTEAAAFVSGLFKDPINLEFEKAYFPYLLINKKRYAGLYWTRTEKYDKLDQKGLASVRRD
SCPLVSIVMNKVLKKILIDRDVDNALAYVKQIIDNLLHNKVDISQLIISKTLAPNYTNPQ
PHAILAERIRKREGSGPNTGDRVDYVIMGGNDKLYNRAEDPLYVLEHNLQLDSKYYLTNQ
LQNPIISIIAPIIGEKGANSMFVVKSIKINTGSMKGGLMGFIKKVESCKGCKGPLKSGEG
PLCHNCKSRSSELYIKTLYDVRELEQKFARLWTQCQRCSGSLHNEVLCSNKNCDIFYMRV
KVKKELQEKVEQLSKW
Download sequence
Identical sequences A7TJ77
tr|A7TJ77|A7TJ77_VANPO 436907.A7TJ77 XP_001645504.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]