SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJ78|A7TJ78_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJ78|A7TJ78_VANPO
Domain Number 1 Region: 649-749
Classification Level Classification E-value
Superfamily AMPKBI-like 1.2e-18
Family AMPKBI-like 0.0019
Further Details:      
 
Domain Number 2 Region: 435-492
Classification Level Classification E-value
Superfamily E set domains 0.0000000224
Family AMPK-beta glycogen binding domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJ78|A7TJ78_VANPO
Sequence length 755
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1004p21
Sequence
MGNHLSIGARHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSELFTSRNNSNRNKIYS
ELAARNNLTTINSSNTNVKESLFKKDYSMGRHPNTVNHVKNRVDFTRNSSNEYSSSSLSS
NTDSAYTPSFFSLGPSTATVEQSTEKVIRLDEQHHPHQNLASKKDIVINHEHRPSILALK
QNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNKKDLRNPILIN
LEYNERNNKNESNFQNEIQPNNLNVNYNNNGNSNNYSADEDMVWNQSLLNGLITSNNDYI
DNNINNKNFNLNHHKYPKFENSISPTFNDSNDGNVHYDGKQHCSGTEGYHFSDKKTSNIV
NRTQFSSLASKQISYRNSSAFSSTFSLDLGSENVRVFLKWRDLIDDIENANISIVSNEIL
SVICMNDLDSENSDSARMVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATD
NLGNIVNWFEVPRGYESIEPFRDNDYVKNEISGGILQPIPNTLGIPSVSSQLSSFSFHAS
RPTTPYSDFAGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDL
DLTTAKATETTTDDEDITKPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDEL
EKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLT
HNIQDSVIAVACTVRYGGKFITQVVYSPCSVENDD
Download sequence
Identical sequences A7TJ78
tr|A7TJ78|A7TJ78_VANPO 436907.A7TJ78 XP_001645505.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]