SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJG4|A7TJG4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJG4|A7TJG4_VANPO
Domain Number 1 Region: 33-165,316-429,852-1083
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.8e-108
Family Calcium ATPase, transmembrane domain M 0.0007
Further Details:      
 
Domain Number 2 Region: 434-453,629-909
Classification Level Classification E-value
Superfamily HAD-like 1.71e-50
Family Meta-cation ATPase, catalytic domain P 0.00026
Further Details:      
 
Domain Number 3 Region: 441-646,684-707
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.54e-34
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0054
Further Details:      
 
Domain Number 4 Region: 166-295
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.29e-22
Family Calcium ATPase, transduction domain A 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJG4|A7TJG4_VANPO
Sequence length 1134
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1061p39
Sequence
MNNDDDDLGLVPDKVQLSTLHDPKSIAQYLQIFHSYDPNVLYQNLQTDPINGIDSSQLHT
RKLKYGDNKLPEHVSKTFMQLILEALNDKTMILLSIAAIVSFLLGLYEVFCQPTQYDPEG
HIIKNVDWIEGIAIMLAVVVVVVVSAANDYQKEKQFSKLSQKKENDKTFTVIRDTATVSL
IPNSQLVVGDIIKLQTGDILPADCILVSGCCDVDESSVTGESDTIKKRPLTESLSYYKDI
KNNASSSASDFVVDIPNDKNVPDCMLISGSKVIAGLGKAVVTAVGISSVHGRTMNALIHG
DRVPDEDAELNTDDFALENSGMTPMQERLSNLADIISVYGCLAATLLFVILFAKYLYNIL
SPNGRFKDLPPAERGNKFLNIFITSVTIIVVAVPEGLPLAVTLALAFATTKMTKDGNLVR
ILKACETMGSATAICSDKTGTLTRNSMTVTKVLIGGKTSDNLNEIQKELGKDILINIALN
STAFENKNYKKPPSSSNPFDSEGSNSNEVDTIETYNSREPYIGSKTEIALLSFANLNLDL
KRLGELQKVRNEPNSKFPTIEKIVQIIPFESSRKWSGLVVKLKDTGTYRLYVKGAAEIIF
KKCSYRRGTDGSLQELDENVINNIQNHIKDFAENALRAISLAHKDLLDYKTWPPAELMDK
DKKDNDCASPDILFNSLLSSSDSTKFDETGLVIDGIFGIQDPLRPGVDESVKQCQESGVT
VRMVTGDNLLTAKAIARNCHILTLEDNYDPHCAMEGPEFRKLTKEERVEILPKLRVLARS
SPEDKRLLVGTLKSMGDIVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTD
DFSSIVNAIKWGRCVSTSIKKFIQFQLTVNITAVFLTFVSAILSEDESSVLTAVQLLWVN
LIMDTLAALALATDKPDKDILKKKPKGRSEPLISFSTWKMILAQAALQLTITFILKFYGA
NIFFGGKDELSGKEQQQLNAMIFNTFVWLQFFTMIVSRKLDEADGITGWKERCTQNNLNF
FQDLFRNYYFIAIMTLIGVLQILIMFYGGIAFSIERQTREMWIVAILCGMLSLPVGVIVR
IIPDDVVRALIPASLFAKFKYILYLEFLPNWDNKPKEEDEESLLEQASNVSTRE
Download sequence
Identical sequences A7TJG4
XP_001645472.1.22633 436907.A7TJG4 tr|A7TJG4|A7TJG4_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]