SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJM3|A7TJM3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJM3|A7TJM3_VANPO
Domain Number 1 Region: 553-858
Classification Level Classification E-value
Superfamily Aldolase 9.89e-77
Family HMGL-like 0.00000206
Further Details:      
 
Domain Number 2 Region: 103-373
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-67
Family BC ATP-binding domain-like 0.00000399
Further Details:      
 
Domain Number 3 Region: 855-1028
Classification Level Classification E-value
Superfamily post-HMGL domain-like 1.61e-49
Family Conserved carboxylase domain 0.0035
Further Details:      
 
Domain Number 4 Region: 17-131
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.01e-39
Family BC N-terminal domain-like 0.000081
Further Details:      
 
Domain Number 5 Region: 354-472
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.28e-37
Family BC C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 6 Region: 1089-1168
Classification Level Classification E-value
Superfamily Single hybrid motif 9.29e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJM3|A7TJM3_VANPO
Sequence length 1178
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_534p47
Sequence
MSKKAFTGMRDAQSLLGNKNKLMVANRGEIPIRIFRTAHELYMRTLAIYSHQDRLSLHRL
KADESYVIGKEGQYTPVGAYLAIDEIIDIAKKHDVDFIHPGYGFLSENAEFAAKVIEAGI
TWIGPPPEVINSVGDKVAARNLAARANVPTVPGTPGPIETAEEAEAFVEKYGYPVIIKAA
YGGGGRGMRVVKEGDSVADAFQRARSEAISAFGNGTCFVERFLERPKHIEVQLLADNYGN
VVHLFERDCSVQRRHQKVVEVAPAKTLPIHVRNAILTDAVKLAKEAGYQNAGTAEFLVDS
QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIASGASLEDLGLFQDKITTRGFAIQC
RITTENPSKNFQPDTGKLEVYRSTGGNGVRLDGGNVYVGAEISPHYDSMLVKCTCLGSTY
EIARRKIIRSLIEFRIRGVKTNIPFLITLLNHEVFIHGEYWTTFIDDTPQLFKMLSSRDR
ATKVLNYLADIAVNGPSIKGQIGLPKLAMNPTVPDIHDSEGNVVNVTNAPPSGWRQILLE
HGPEVFAKKVREFDGTLIMDTTWRDAHQSLLATRVRTHDLVTIAPTTAHALAGAFALECW
GGATFDVAMRFLHEDPWERLRKLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK
DNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYMEIAD
KIVKMGTHILGIKDMAGTLKPAAAKILIGSLRTKYPNLPIHVHSHDSAGTAVTSMIACAL
AGADVVDVATNSMSGLTSQASVNAVLASLDSSVNTNIDVNHVTELDAYWAEIRLLYSGFD
ADLKGPDPDVYEHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTS
KVVGDLAQFMVTNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDILRNK
RKKLTCRPGLELAPFDLEKIREDLEGRFGDVDECDVASYNMYPKVFEDFQKVRETYGDLS
ILPTKNFLAPPVIGEEIEIILEQGKNLIIKFQAIGDLRKDTGTREVYFELNGELRQILVV
DKTQKVDSVAKPKADAHDPFQIGAPMAGVIVEVKVHKGSLVKKGEPIAVLSAMKMEMVIS
SVADGLVKEVFVNDGDNVDASDLLVLLEDTVPPAEKEN
Download sequence
Identical sequences A7TJM3
XP_001645424.1.22633 436907.A7TJM3 tr|A7TJM3|A7TJM3_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]