SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJM8|A7TJM8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TJM8|A7TJM8_VANPO
Domain Number - Region: 31-148
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.034
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJM8|A7TJM8_VANPO
Sequence length 199
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_534p52
Sequence
MIGRRYLHLLRELRPSDIFKEDSLSPRKIALQIILLQLFYYFTAAVLFYGWGTFFGYDID
IKKWLFSWEAVDFTNSVGLSVSVLWLVDALICVIFLTVIVGRSKLAWDFAITIHAINLII
VFFYTGSLPSLQWLLIQVLSMLILVFLGTWTSRWKELRDTFFEGLLDSTDGLPSLSNNNS
GSESNPNNSIQMKDLESQR
Download sequence
Identical sequences A7TJM8
436907.A7TJM8 XP_001645429.1.22633 tr|A7TJM8|A7TJM8_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]