SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJR3|A7TJR3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TJR3|A7TJR3_VANPO
Domain Number - Region: 59-81
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0119
Family Proteinase A inhibitor IA3 0.0056
Further Details:      
 
Domain Number - Region: 9-64
Classification Level Classification E-value
Superfamily Tropomyosin 0.0142
Family Tropomyosin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJR3|A7TJR3_VANPO
Sequence length 93
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1058p29
Sequence
MSEDKSYLEQSKDYVTHKKDELSHKFHGEDKKVDKPDENIDKPESNLESQKPRSQALKED
VNEYYQSAKDSLSGAAKYVSSHIGGGGSGGTSN
Download sequence
Identical sequences A7TJR3
tr|A7TJR3|A7TJR3_VANPO XP_001645350.1.22633 436907.A7TJR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]