SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJX1|A7TJX1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJX1|A7TJX1_VANPO
Domain Number 1 Region: 129-404
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.47e-88
Family DnaQ-like 3'-5' exonuclease 0.00000000258
Further Details:      
 
Domain Number 2 Region: 421-511
Classification Level Classification E-value
Superfamily HRDC-like 1.92e-22
Family EXOSC10 HRDC domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJX1|A7TJX1_VANPO
Sequence length 746
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1037p29
Sequence
MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI
NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ
SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA
HPYEVEIDKQEYNASVLQVAEPLKSQPWNSESTWVDTSEALQSMLDKLKECTEIAVDLEH
HDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQ
RDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAY
ARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEK
EEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPA
GVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTI
SQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLA
GRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGF
EDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRENSKKRKGDPFGE
ENGLEGPKAAKKRKQINRGKNVSFKR
Download sequence
Identical sequences A7TJX1
tr|A7TJX1|A7TJX1_VANPO XP_001645291.1.22633 436907.A7TJX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]