SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TJX6|A7TJX6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TJX6|A7TJX6_VANPO
Domain Number 1 Region: 226-377
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.29e-27
Family Retroviral integrase, catalytic domain 0.0074
Further Details:      
 
Domain Number 2 Region: 817-1029,1067-1235
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000000169
Family Reverse transcriptase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TJX6|A7TJX6_VANPO
Sequence length 1295
Comment Tkp1 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1037p34
Sequence
MLMTIPLGSPNHVDDEFDLPGYLLLDSGASTSIIRHSSLLHFPQQPIHIGVQDAQDNPIP
ISSTGILKFHFANGPPVKISAASSPNIRYDLISLDELDDAGIYADFSTRSLRDKDNNVIA
TLLKHGPFYWLSTKYLMLPARSRNHRINNILPRFSFEFIHRLFGHVNIKIIKDSIRKGLI
KNISYDNIDWSGFDTFQCPDCLKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNM
PTSSPTYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFGTQFDTKVLVFQMDRGS
EFTNAEIRHFFRENGIQPCYTSVGDSRAHGVAERLNRTLLDDCRTLLESSGLSPHLWFYS
VEFATLIRNALLNTTYKTSARARAGLAGLDASTILPFGQHVITHDTNPIDKLHVRGHHGY
ALTPSKESHGYLIYVPHLHKVLDTSNYVVIRSDTNISADHNYDSTVFDPLMQSIARPYDD
FLNDTSAPALIDDNSSEPDNSTSAPNSDSELSDDPDLDTAMIHSRPESIDTQGTNSDVSP
TSNPVTTIPLTSDIYTDPDSDTDDDSDSPLSFYHSDFNKPISSSTFDEELPPDVIPISDD
NTTPSVLEDDVLPEIPSLSDSPPALPDQLIDSSPKNSDSGGIIADTTISLDTSPDISHSL
AISPSGGTIDDLNTSSTNPLSLSLSPQNSNSGGITQTSVSTDLGGIGKEQDSSKKRNREN
DENNDKDHLPYWEKNNMSSIKFPPKQRRRIHYINSVKHAVNNPPSVGNTSMSYRDAISSN
QNVREKELYRKAYMKELDQLMKHNTWDNSRIYDVKEVNPKKIINSMIIFTTKRDGTHKCR
FVARGDQQNAGTYDDSLIANTIHHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELY
IRTPPHLGHKNKIFKLEKSLYGLKQSGANWYENIKKYLTEDCGMSNIRGWPCAFKNEDLI
VCLFVDDIIVFGKKHKKCMDLVQLLKLRYETKVVNDGKIEKAESRDYDILGLEITYRRSK
SLSFGMEKSLEQKIPSLGVTLNSEKRRMKAPGQPGIILSDSKLDMSEAEYKRKVKLMQKL
VGLASYLGYKYRYDLLYYINILAQHTLYPSNQVLSLTYQLIQYIWDTRNKRLIWPKAKER
NTQRVTAITDAAFANQPGYKSQVGYFILVNNKIITARSTKATLTCISSTESELYAISMVI
PLLNSIKMLMETITGNQVKNKLITDSAPAISIINSQDETKLRNKYFGARSMKIRDEVKYS
HLKLEYVNTDNNIADILTKALPAKRFNDLTNVWMV
Download sequence
Identical sequences A7TJX6
436907.A7TJX6 XP_001645296.1.22633 tr|A7TJX6|A7TJX6_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]