SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TK21|A7TK21_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TK21|A7TK21_VANPO
Domain Number 1 Region: 577-871
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-57
Family Tandem AAA-ATPase domain 0.00011
Further Details:      
 
Domain Number 2 Region: 935-1047
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.04e-19
Family RecQ helicase DNA-binding domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 1115-1193
Classification Level Classification E-value
Superfamily HRDC-like 0.00000000000001
Family HRDC domain from helicases 0.00093
Further Details:      
 
Domain Number 4 Region: 434-500,529-613,644-668
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000191
Family Tandem AAA-ATPase domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TK21|A7TK21_VANPO
Sequence length 1280
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1060p23
Sequence
MVVKPSNSLIKQHKWLKNEESSLGDAQVAMDIVNGSSTVKTDISESFLNKVNNTGQIITA
SQSTSISNKEEDEEPSKDGDSQIMQLQDVIHIQGNMIKILNKKCQLTGNRCDILSSTKLS
QIEKDQQINSILCELNSVSEELRLMEVTLLKISKSCISEDLNEGASLPNLKNQIHNEPNN
TNNQERIDYNNLLDKTNDIPSIDLTSFDDQKSKHNVLPNVLEKEIISNREEIEYNEEINL
IDHNSDEFKEIPTTIERRLREKKQINYKIPEKDDHFEYGMGARPNPNYDESVEITMDAEF
DDNSSYLNTRDYGSDGNMNQSDIDFVVSDTFQQTQDADYYGSDEEVVDASDADVGESIIF
SHHKSMEMQVILSSPIKEDRIETKESQQIKNLAPTNYDTIENDPIIEDTNKSTLFYSTMT
QLSDVEVVNSDDNSKSTKNYEVELDENLLSDDSDFDLERENLTQHSTMKDVDDELKIISE
KPIESEVIELQEEPIIQQFHIPSHATVPGKAKDYNWTEELYYRLHNTFRIQSFRQNQLEA
INATLSGRDVFVLMPTGGGKSLCYQLPAIVKSGTTSGTTIVISPLISLMQDQVEHLLDKN
IKACMISSKSTAAQRKETFNLFVNGLLDLVYISPEMISASQQCKRAINKLYSSSKLSRIV
VDEAHCVSNWGHDFRPDYKSLSFFKREYPNIPLVALTATASEQVRMDIIANLEMHNPLTL
KQSFNRTNLNYQVKAKSKETINEICTLLKGRFKNQSGIIYCHSKNSCEQVAEQISQHKIR
CAFYHAGIDPAERLQIQKAWQKNQIQVICATVAFGMGIDKPDVRYVFHYTVPRTLEGYYQ
ETGRAGRDGLYSYCICYFSFKDVRTLQTMIQKDKNLDRINKQKHLEKLQQVASYCDNVTD
CRRHQILKYFNEDFDPSLCEKNCDNCKNSGSTYMEEREITEEAIAIVKLVKYLKNDKVTR
LYCQDIFKGSRNAKIVQLGHDRLETHGLGKAFSKSDLERIFSQLITLRILQEYAVVNGSG
FSSSYVTIGSNSRLVEQGKMKVKMKFTVQNPSSNPSSNPSSRDKSITNFSSMISERSNKT
SSFTSTNLSPNNSNVGVNYPIVLQDNSSLQSTQELSHITVSYESLRAVSMSLGNRMNPPI
TNYLPDVLIKKIAMALPETEDEFISIVGNFSNHTRKYKYFKDTMTNLRLQRNQIKKDNKV
SNSFQPSGESYPINDQNSVDETQFKPSSREHKNNLEIIQKIRDSQKVKNIFDGDVIKQKK
SSQKRAYRKPKRSYRKRKRF
Download sequence
Identical sequences A7TK21
tr|A7TK21|A7TK21_VANPO 436907.A7TK21 XP_001645225.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]