SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TK37|A7TK37_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TK37|A7TK37_VANPO
Domain Number 1 Region: 170-390
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.69e-88
Family ATP sulfurylase catalytic domain 0.00000000398
Further Details:      
 
Domain Number 2 Region: 3-169
Classification Level Classification E-value
Superfamily PUA domain-like 1.59e-50
Family ATP sulfurylase N-terminal domain 0.000000503
Further Details:      
 
Domain Number 3 Region: 391-508
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.43e-33
Family ATP sulfurylase C-terminal domain 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TK37|A7TK37_VANPO
Sequence length 509
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1060p39
Sequence
MPEPHGGELKDLLARDSNKRDQLLQLSKSIDSNKIWNLSDRQICDIELIINGGFSPLSGF
LNQSSYNSVVENSRLPNGILWTIPITLDVNKSFAENLSKNDKLLLLQDNEIPIAILTVDD
IYKPDKKIEAEKVFRGDPEHPAIDYLFNKAGDYYIGGEIEAIQLPVHYDYLGFRKTPSQL
RSDFNSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKILIHPVVGLTKPGDIDHHTRV
RVYQEIVKRYPSGLADLSLLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNS
KGVDFYGPYDAQLLVESYKNELNIEVVPFRMVTYLPDEDRYAPIDEIDTTKVKTLNISGT
ELRKRLRDGGEIPEWFSYPEVVKILRESNPPRSKQGFALLLKNDLKLSLNQLSIALLSTF
LQFSGHRHYKIFKHKNDSDYASLINDFIQSGTGLLITDELNKEFSKPQNFFTIGHSPEDS
ITLGNNADSIHHVIQKVVLFLEDNGFISF
Download sequence
Identical sequences A7TK37
XP_001645241.1.22633 tr|A7TK37|A7TK37_VANPO 436907.A7TK37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]