SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TKA4|A7TKA4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TKA4|A7TKA4_VANPO
Domain Number 1 Region: 506-546,595-713
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000356
Family Reverse transcriptase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TKA4|A7TKA4_VANPO
Sequence length 864
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1062p49
Sequence
MKSLYEYISHICNNDENKSIEFENLLLSGHLTGFNNFLFSGIIIENSESIGIPQIPSSNL
EHKAIIDETIVFLLKNKLFNNVLTYGYRLAKNFDVTTALHCESVNSNVQIINNSTWKILR
NLIGNSNFVNILVNFTVILITDDTFMQVIGNRMNMKNKLPTKPIVSSDGEYLLNLLYSPI
NVKNYLHKNSWEFRYYNILPKVGHIDELRELIFSPTLMKISRLLKKNINEMLSQIVSNHK
KSIKYLNILNNICPANTDPEIPHLERQINPKDVNRFLIVILEKLLPKDCLGSSKNKSYLF
SKISKLINLPMYSNMSFIEIVEGLKTNDFKIFTSGKKLSLPEFNKLKLIIHQFTSWIFRF
LVPNIISTFFYCTNVSSGIEIIFFRHDVWNKISMKFLDGYFSEYMIENSVCKNHESYTLS
EYNHSKLRVIPKSAKDEFRTLAIPLKGMDSDELIAYKENNKNIIEPVKAILEYLRSCRKT
HFNKLYSTSEISDYINLFERQLLKQFSFLPVLHVIKFDIKSCYDSLPRIKLIEVLQKLLE
CEKGFYVRSQSFYDLNKKILQTKFIVNGSRKPKDSEIYIDNVKTTFFSKEDLLEVVKTEI
FKTSLVYGDKCYLRKDGLFQGSSLSALLVDLLYDDLLEYYPIFRQISGEHSIVLRLADDF
LIITTSQSQFMELKCLCTNGFKEYGAILNSDKIVYNSTNSKKVNIISFCAVNICINSLNV
WKHSKEFNVPLINLTSPKMIYRRLNSLFKMRLSYAITSPYPSRTKLVLMQLYHVSKNVSV
IYKKAFEKKKIIKEDFGRFMESIIETTMNTFPELSDNQEFLNCVRTVIDVTFFRTLVPNR
YRYKNALSYLKCRKLKHAKYIYES
Download sequence
Identical sequences A7TKA4
tr|A7TKA4|A7TKA4_VANPO XP_001645197.1.22633 436907.A7TKA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]