SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TKG9|A7TKG9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TKG9|A7TKG9_VANPO
Domain Number 1 Region: 180-622
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.11e-84
Family Reverse transcriptase 0.00018
Further Details:      
 
Domain Number 2 Region: 821-960
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.07e-29
Family Retroviral integrase, catalytic domain 0.0094
Further Details:      
 
Weak hits

Sequence:  tr|A7TKG9|A7TKG9_VANPO
Domain Number - Region: 44-137
Classification Level Classification E-value
Superfamily Acid proteases 0.0231
Family Retroviral protease (retropepsin) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TKG9|A7TKG9_VANPO
Sequence length 1130
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1035p3
Sequence
MSRMSSLLLNPLMILLENQKNQKEPQPLYRKFRRGLKESDTLIVLDTGADTNFTYSNLWS
KNDSITLQDLHISKEKSRSCIPLTVTPAFGVSLVINQQVFLRIRIGTATICDWFYLIPQK
RSHIILGKPLLKKLHYQLSPSCESLTIADTTIDVTRFPGISATSTLLQISKTPFLKSLKT
KFPTVFSSNFSLDLHHDFLAHVNLINFPYTTPKAYFTSGLRREAIKKYVNQSLENGLIEP
LSPDELVAVSPVFALPQSSEKIRIITDLRKVNKCLQYTPRPIPTTQSILSELSHHTVFSA
FDIRKAYQQLPLTGDKLGIITEFGTYKFTRMPYGLASAPYWWGEFLQRIINDISIPTTTV
IRYYYDDILVASQDHDEHYQVVLKLFEALHRHGLSISEEKIQLASDTVIFLGYEISQNRV
SLESSKIETIRKWPLPTTKEAILKFIGFINYLRNFIPDTSERLRPFYDVLDKKLTPTLPP
PHILIPNLTPSFNLFKQLITRSLTLKLFDPQAPTIIFSDASLKGGASIILQPEVHNNTTL
LFPISFLSVRFNPTQQRYSTVERELFSVLHALNKGELLLSPDVTVYTDNKGIISIGNSDR
NTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTS
NLTLLSADSDAETSSTTNPEPSTEAPNSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADKI
SSIPPIFSKIIDRFYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAM
ADEKLWNPNSNLLLLDVVRLCSRCETYEKFSDLPIELPEIHRTPVFSRWHLDFAGPLPAH
NGYKYFLLAADYTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHMLVTDNGSPFANNIV
PTIAAHLKIKYYQSSAYHPRGNSKAERSVKMIKEVIKKMDPKYEKWTSNLSIAAHIVNNT
KMIYGYAPREIAFGVPARKIGTEYLQAVESILNAEDKPPEDMATTENVHLSLMRHRNTRT
IRSKTMDERVKVRELLRNARKDTDKYVPYTRGEVVYRYRPKRNKFEPTWDGPYYIHEVLG
KNTYKLRNWDGSVREATYDGSKLKPAYSYYGSPIRTAAEYTRVYGDKERK
Download sequence
Identical sequences A7TKG9
tr|A7TKG9|A7TKG9_VANPO XP_001645049.1.22633 436907.A7TKG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]