SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TKH0|A7TKH0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TKH0|A7TKH0_VANPO
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000458
Family Tropomyosin 0.014
Further Details:      
 
Weak hits

Sequence:  tr|A7TKH0|A7TKH0_VANPO
Domain Number - Region: 338-422
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00105
Family Cytochrome c3-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TKH0|A7TKH0_VANPO
Sequence length 475
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1035p4
Sequence
MSNQSDITEDRFISLEDNVKSMDGRMTSMESSLQTILTSLQNMEARSNKEETQTNILKKG
LENTSTQFSAVQKEEAAIEGRILEDERKQASLISEVGKIESYLNSEQDALHNFIQDKITT
ELAKFKNGKVSSKEEILMKVNRYFPEIITNPNSPLLAGCTKSYGEVSLVAPTEIHLKTEN
YREPAENLLKIQSLLKGKHVSFDSWGPALHNFCGTGVTDHLYNDRKEPVDWITAIYHFFK
NYEFSSKTRKDIVKLQKFQPTPGSNARSYLLDLIELAKAVRGASTLTMTITKVADILDSE
FPALPIPDIAEMRKFDELIAFVQLYVRDGVTFPNKTSSTPFFAINRAYPSKSKPKQKVSA
ANYYCVNCRCSKCSGNLKPYMKSGFCINCHCAKCTPRVKRFSKQDITNIKVNMLEAETEV
FPSDIDDDEFGTEFAAVLADESYEFSSLESINDSIGESEEPEGTTATLQEIQARP
Download sequence
Identical sequences A7TKH0
436907.A7TKH0 XP_001645050.1.22633 tr|A7TKH0|A7TKH0_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]