SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TKK6|A7TKK6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TKK6|A7TKK6_VANPO
Domain Number 1 Region: 316-466,587-732
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.48e-79
Family Protein kinases, catalytic subunit 0.0000134
Further Details:      
 
Domain Number 2 Region: 1048-1171
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000384
Family CheY-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TKK6|A7TKK6_VANPO
Sequence length 1181
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1035p40
Sequence
EGKDLLVADTLKLARDKVEAVLRLDNAMTYSFRINNEVNNYVFQLIKEQIENNKIFISHS
LSAPIDNTPLSNFPDQRSVQSSTSSVPTLTNRNILNLIQAESRNNSNLPSPLPQRPPVMF
SDTYMNADVIPNSSMSSIPKSESESEILIPQPKMGRISREGGPQEIPDALSATFGEQEIA
DIGSNLRHESDPSSSSNTPITSSFNNRLLGNASSHSLVVPKLKTSIMLTPRRGSPLLNSS
SSSTSNTTALNQPTRSSSGSKLNIERARSPFNSPFTIARDFLTPEQSSNVSNLPKQPLSP
LLLATNTAKSPNPSIRDYNVIKPISKGAYGSVYLARKKLTGDYVAIKVLKKSDMIAKNQV
TNIKSERAIMMVQSEKSYVARLYESFQNKDNLFLVMEYLPGGDLATVIKMMGYLPDKWAK
QYISEVIIGVEDMHKNGIIHHDLKPDNLLIGRDGHLKLTDFGLSRAGLVQRHQNVPSKSK
QTSLVAPLTQSNAGSSILQGNNSDSEKASAGTLAELNIRERERSDSVSSSLSNNESIIRR
NNSIGSFTLLDLTRSETPTTSIITRPRASSTLSESFDINSVTDYALFHPDDSKQKKKFFG
TPDYLAPETIKGTGEDNQCDWWSVGCILFELYFGYPPFHANTPEAVFENILSHNIAWPSF
SSPEEEKEYISVEAKDLVTKLLVSDPALRLGANGASEIKEHPYFKDVDWDHVYDEKASFV
PSVGHPEDTDYFELRGAVLEDLGEDSDDGREDPSGDMFVSTATPKSLLADDLMRKVINSQ
MSTPYNSSGSRTPLNKLSISSVLESDSQKNSDQGSPTLKQVPSAIPPHMRERRYSKLNDP
QAEFGSFNFRNLSALDKANKDAISRLKNEHLSDHPGVHRRTSSSSLPSSSSEGSVSKLRT
AKAPSVSSPNNMHKPRSSIVSETGSIRSISPDRSLNITYDIDSRKNSVDDTDPNLSPLMV
NIPPQNDSFSIKQKSHLSPMGTNSQLMGSPQLGKARCLSKSSQRTNSTELSSEDSQRLHA
ISKVNSVRNRRRSARKNSTEADEMKYHMDILLCEPIPIHRYCTTSGLESLGCTVVAVGAG
DELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHTNGINSTTPIVAATCYFEEASNTN
VFSDVLEKPISIQTLRKLISKYALIKSQRQEESIQSDNDTS
Download sequence
Identical sequences A7TKK6
XP_001645086.1.22633 tr|A7TKK6|A7TKK6_VANPO 436907.A7TKK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]