SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TKW3|A7TKW3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TKW3|A7TKW3_VANPO
Domain Number 1 Region: 67-167,266-359,670-864
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.01e-75
Family Calcium ATPase, transmembrane domain M 0.0023
Further Details:      
 
Domain Number 2 Region: 362-408,456-670
Classification Level Classification E-value
Superfamily HAD-like 1.02e-38
Family Meta-cation ATPase, catalytic domain P 0.00052
Further Details:      
 
Domain Number 3 Region: 168-265
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.22e-26
Family Calcium ATPase, transduction domain A 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TKW3|A7TKW3_VANPO
Sequence length 907
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1025p39
Sequence
MSDSEEVISQEKPPQEYSDSSSSSSDEDEDIDALIEDLQSNHGGDDDDDESEDEHVAAGE
ARVIPEEMLQTDPSYGLSSDEVARRRKKYGLNQMSEEVENLFIKFLMFFIGPIQFVMEAA
AILAAGLSDWVDFGVICGLLMLNATVGFVQEFQAGSIVDELKKTLANSAIVIRDGQLVEV
PANEIVPGDILQLEDGTIIPADGRLVTENCFVQIDQSAITGESLAVDKHYGDQAFSSSTV
KRGEAFMIVTAIGDNTFVGRAAALVNQASGGQGHFTEVLNGIGVILLVLVIVTLLVVWTA
GFYRTVNIVTILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAG
VEILCSDKTGTLTKNKLTLHEPYTVEGVSEDDLMLTACLAASRKKKGLDAIDKAFLKSLI
HYPVAKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIP
EDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLG
LRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVF
PQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGL
SAIIDALKTSRQIFHRMYAYVVYRIALSLHLEIFLGLWIAILNHSLDIDLIVFIAIFADV
ATLAIAYDNAPYSPKPVKWDLPRLWGMSIILGILLAIGTWIPLTTMFLPKGGIIQNFGSI
DGVLFLEISLTENWLIFITRAAGPFWSSIPSWQLTGAVFAVDVIATMFTLFGWWSQNWTD
IVTVVRIYIWSVGIFCVLGGAYYLMSESETFDRLMNGKPLKEEKPTRSVEDFLAAMQRVS
TQHEKEN
Download sequence
Identical sequences A7TKW3
tr|A7TKW3|A7TKW3_VANPO XP_001644976.1.22633 436907.A7TKW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]