SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TL26|A7TL26_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TL26|A7TL26_VANPO
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.11e-39
Family Nip7p homolog, N-terminal domain 0.0000404
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 3.09e-23
Family PUA domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TL26|A7TL26_VANPO
Sequence length 181
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1065p1
Sequence
MRQLTEEETKVVFEKLAGYIGRNISYLVDNKEQPHVFRLQKDRVYYVSEHVAKLATCVAR
PNLMSLGICLGKFTKTGKFRLHITSLTILAKYAKYKIWVKPNGEMPFLYGNHVLKAHVGK
MSDDIPEHAGVIIFSMNDNPLGFGVSAKSTSESRDLAPTAIVAFRQSDIGEYLRDEDTLF
T
Download sequence
Identical sequences A7TL26
436907.A7TL26 XP_001644847.1.22633 tr|A7TL26|A7TL26_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]