SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TLA9|A7TLA9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TLA9|A7TLA9_VANPO
Domain Number 1 Region: 135-387
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.98e-70
Family Extended AAA-ATPase domain 0.00000147
Further Details:      
 
Weak hits

Sequence:  tr|A7TLA9|A7TLA9_VANPO
Domain Number - Region: 19-64
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TLA9|A7TLA9_VANPO
Sequence length 403
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1041p42
Sequence
MSSVATASVNAHEGGIKPYFEQKIQETELKIHEKTENLRRLEAQRNALNDKVRFIKDELR
LLQEPGSYVGEVIKVVSDKRVLVKVQPEGKYIVDVAKDINVKDLKPSQRVCLKSDTYMLH
KVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPK
GVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPS
IIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDP
ALLRPGRIDRKIEFPPPTVAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVC
TEAGMYALRERRIHVTQEDFELAVSKVMNKGSETAISVAKLFK
Download sequence
Identical sequences A7TLA9
tr|A7TLA9|A7TLA9_VANPO XP_001644842.1.22633 436907.A7TLA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]