SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TLL4|A7TLL4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TLL4|A7TLL4_VANPO
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 9.81e-16
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TLL4|A7TLL4_VANPO
Sequence length 569
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1056p6
Sequence
MIIYEDDKYACVSCIRGHRSTTCRHTNRMLVKVRTRGRPSAVDMRKVILVDTSSEVSSVS
GSTEINHNSKGGNSAGGSGGRNSSSPISNGVTSPTTPSCGGKSMIYSSSSGSGTGSIDFP
DEFGGSDMGCPGMNVQPVLFLRAKRKQNALLVNGKLKIIVENNNNNNNSNNNSTVASENH
NGDSEDVEESEASKFKYVTEKEYLQKYGTDGNASITNNKISSTGKIHTHDGAHEEIDGMR
LCSCREERSTNKTKPSPGATGETMGGNIHTGCCTTGSTPTAIPSTVPSVIPSISMEKTLS
FTTPSASNDVQESDPISAPMLMASSSNSPGLEPTAVGFLDSLKVEDHGLGLVSNGDIRLP
PPHAFAVQPSNNGHHMQQQQQQTHQFGITQDQCVVDLLTHRGLYLSSTCTCPDDNCRCVN
CLVHRNENELNSYIQKSGVPLTHFGEAHLTNTMLEDCCYGCQCTPEDCQCNDCLVHGTEI
LSFDKLLFYGILNVPLRRKSMIKFKKTLIPSKFWWDFLKLQVPLMTEQQLESLDMLSWFE
NIIETYKEDLQNSSAYSSSYMPQTTSMFS
Download sequence
Identical sequences A7TLL4
XP_001644664.1.22633 tr|A7TLL4|A7TLL4_VANPO 436907.A7TLL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]