SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TLU7|A7TLU7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TLU7|A7TLU7_VANPO
Domain Number 1 Region: 632-651,709-950
Classification Level Classification E-value
Superfamily HAD-like 5.81e-45
Family Meta-cation ATPase, catalytic domain P 0.00045
Further Details:      
 
Domain Number 2 Region: 431-517
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.03e-22
Family Calcium ATPase, transduction domain A 0.0023
Further Details:      
 
Domain Number 3 Region: 92-158
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.14e-18
Family HMA, heavy metal-associated domain 0.0003
Further Details:      
 
Domain Number 4 Region: 2-72
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 5.24e-16
Family HMA, heavy metal-associated domain 0.00019
Further Details:      
 
Domain Number 5 Region: 396-416,519-627,894-954
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000432
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 
Weak hits

Sequence:  tr|A7TLU7|A7TLU7_VANPO
Domain Number - Region: 206-242
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0286
Family HMA, heavy metal-associated domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TLU7|A7TLU7_VANPO
Sequence length 1018
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_526p42
Sequence
MRRSLFVVEGMTCSACTNTIVAQVESLEGVKNCQVSLVTNECVAVYDESLSTVQDILNCI
EDCGFDCEFISTDVQETASSDLNLNLNLNLGLLTVQGMTCSACTSTITNQLEKINGVEDV
QVSLVTEECHVKFVPSVVSIQDIKETIEDCGFDANIVSQVELNQDSNKIGSHLKKIPFKL
IGLNESSNVNELELFFNDINKNGLISNISVEDGSATIEYNQDLLGIRSIVNNLNSFGYDV
MVNSTLDNSTQLKLLSRIKEIQYWKSTFIKSFFISVLNMLLYMWIPMGFPHLMKQKLFPY
NQTFIKGLYYRDVISFIFTTYVQFKLGIYFYRATWSSYKHGAGTMDTLVCISTTFAYTFS
IYSIIYNINNKNSSDALPNVIFSTSSMLIAFISFGKYLENKAKAKTSTALSKLISLTPST
CTILENGDASSPLEISTEYLQPGDIIEVRAGMRIPADGIITSGETEIDESLMTGESLYVP
KSIGDAVIGGTVNGIGLFYFKATNIGDDTRLSNIIKTMKQAQMTKAPIQRYADYLASIFV
PCILFLSLMTFIIWGIVCKVFDHLPPVFADSTHGKFYMCFQIAISVVVVACPCALGLAAP
TAIMVGTGIGAENGVLIKGGDKLELFNAIKIFIFDKTGTLTTGCMDAETFIPENNVELTG
EYIMVIKAACGTTEHPVSKAIKNYCEMLIMDQNISVPTNMEIISNETVLGKGIKCRCEVN
GKSYDVIIGSKKLFSNELKDDVNVEDGYTVSFVSINGKLIGRFEIVDSVKSDAYDTVQYL
MALGYQCYMVTGDNHSSAMKIANTVGIPYNNVYSEVTPDGKCEIVAQLQNETNEKIAFVG
DGINDSPALVSSDLGIAISTGTDIALEAADVVILSDEDPKRSTLKRLAYALNISQKTFRR
IKMNLFWALFYNTFMIPVAMGLLAPWGIILHPIAASLAMAMSSVSVVLSSLALKRWKPFD
ITTAPIKRQASTRDTTHSWLKPFHLTRTNNSSQDIELQTNLLNNDDNNDNSSSSQSLT
Download sequence
Identical sequences A7TLU7
XP_001644647.1.22633 tr|A7TLU7|A7TLU7_VANPO 436907.A7TLU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]