SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TLX0|A7TLX0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TLX0|A7TLX0_VANPO
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.07e-34
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 139-209
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 5.89e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.0000137
Further Details:      
 
Domain Number 3 Region: 257-343
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 6.8e-18
Family HSP40/DnaJ peptide-binding domain 0.0000163
Further Details:      
 
Domain Number 4 Region: 108-133,184-266
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000183
Family HSP40/DnaJ peptide-binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TLX0|A7TLX0_VANPO
Sequence length 408
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1003p12
Sequence
MVKETKFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEKFKECSGAYEVLSDS
QKREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQRGKDIRHEIQ
NTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVKKCSSCGGQGVKFVTRQMGPMIQRF
QTECDVCHGSGDIIDPKDRCKECKGNKVANERKVLEVHVEPGMREGQKVTFKGEADQAPD
IIPGDVIFVVTEKPHKHFKRSGDDLLYEAEVDLLTAIAGGDFAIEHVSGDWLKVTIVPGE
VISPGVRKVIDGKGMPVQKYGGYGNLIITFKIKFPENHFADEAKLKALEDILPPRTEVKI
PPKAHIDDCVLTEFDPVKYGNNNNRRGQSYDSDDEDHHGGEGVQCASQ
Download sequence
Identical sequences A7TLX0
436907.A7TLX0 XP_001644565.1.22633 tr|A7TLX0|A7TLX0_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]