SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TLY1|A7TLY1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TLY1|A7TLY1_VANPO
Domain Number 1 Region: 528-565,600-683
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.23e-22
Family Mannose-binding lectins 0.0049
Further Details:      
 
Domain Number 2 Region: 266-338
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000402
Family Matrix metalloproteases, catalytic domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TLY1|A7TLY1_VANPO
Sequence length 684
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1003p23
Sequence
MSEIELFNLQENALVTSPCLIIHGKCSKQNGSKNIQVQHPALPTLNFPVIDNFFKATIIL
NPGSNRLTFVTDTNISKVVTCIYSPQYQNLPIHLCLLVANDSPLEFDSPRSQKDKEGGNN
LDLAIRKLRIGGRLMQAFTNEQMLRNGFGHRTFQFVEEYTWDTQFQTRQQMRNTIKIHIL
RSDKSTKEIRDYDIAQQNPKAKDGGGLFGVAMDALKKYGGPFTNSDKPVQAAVMFLDTHW
DGKLITGHAALGGGTSDIKLAIFGSHGLYSWPPSMEQLIPYMLDSTEASTKEVANDCNEC
GTHWECLVVTLGAFMHEIGHLLGCPHQENGVMLRDYTRLNRSFLTQEAFSVRTKSYGAKP
PIYPKEECGWHRLDMLRFLYHPSFTLPEDYYDPSFMRPTRLNNPGIAEPSLYPLGNGTCT
INSEGGIYCVEIVCGDLARAYIEYIPKSLGGQGPQHKLTLSIQDIRSRIPPDHLAKHGND
FKISLLVANGPGKTFDNFPNQMNISTIPMDRYGFGKNVHGIKSTMLGGGNRGSEIDIIPL
DIANIVAVRIYHGGALDGIRFYQKRQDPNKPPTIPSRTYAGKLTNSMKDLAIKEADNNVL
FGKETRNYSDVIMEPGEIITGFNVRCGAWIDAVQLITSYGRITQMFGNANGGGLGKLIAP
EGKYILGLYGRMSNWVDAMGIVYG
Download sequence
Identical sequences A7TLY1
tr|A7TLY1|A7TLY1_VANPO 436907.A7TLY1 XP_001644576.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]