SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TM31|A7TM31_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TM31|A7TM31_VANPO
Domain Number 1 Region: 10-122,264-355,802-1049
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.15e-102
Family Calcium ATPase, transmembrane domain M 0.0011
Further Details:      
 
Domain Number 2 Region: 360-379,587-861
Classification Level Classification E-value
Superfamily HAD-like 3.93e-50
Family Meta-cation ATPase, catalytic domain P 0.00016
Further Details:      
 
Domain Number 3 Region: 368-402,431-644
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 5.45e-50
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0019
Further Details:      
 
Domain Number 4 Region: 122-233
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.28e-29
Family Calcium ATPase, transduction domain A 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TM31|A7TM31_VANPO
Sequence length 1091
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1052p20
Sequence
MASIEYDYNEFYALSPDETATLLKTDTLVGLSQNDVPKRLSENGDNSLGDDSKIDYKAMV
IHQICNAMILVLFISMIISFAIRDWITGGVISFVVGVNVVIGLLQEYKATKTMNSLKALS
SPNAHVIRDGKSETIPSKEVVVGDICLVKVGDTIPADLRLFQSNNFETDEALLTGESLPV
NKDPEAIYEKNIDIPVGDRLNIAYSSSTVVKGRASGIVVKTGLNTEIGKIAKSLQNTENL
ISRDPTKTFWQNSWITIKQSLGAFLGTTIGTPLHRKLSKLAILLFWVAVVFAIVVMASQK
FDVDRGVAIYAICVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDI
CSDKTGTLTQGKMIARQVWIPKFGTVSITSSNEPFNPTIGETSLIPSLSPYEYSHNETED
VGIIQSFKEKYYSDELPKSLNKNLFHKWLETSTLATISTVFQDKETQEWKAHGDPTEIAI
QVFAAKMDLPRSKLTGEVFGAQDKDDNSVSSMDEEQEKKTGSDSAQFVHVAEYPFDSTIK
RMSAIYQNRDENTHEVYTKGAFEGVLNCCSYWYGADGTLQPMTDDDVETIKKNVDTLSSE
GLRVLAFASKSYKDSDLDNSTMHSILHSRTFVENDLIFLGLIGIYDPPRPETKGAVKKFH
QAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYPKEVVDVMVMTGSQFDNLSEEEIDNL
PVLPLVIARCSPQTKVRMIEALHRRNKFCAMTGDGVNDSPSLKLANVGIAMGINGSDVAK
DASDIVLSDDNFASILNAVEEGRRMADNIQKFVLQLLAENVAQALYLIIGLVFMDKDHKS
VFPLSPVEVLWVIVVTSCFPAMGLGLEKAAPDLMDRPPNDSKHGIFTWEVIIDMFAYGIL
MAGCCMSTFTSIMYGFFDGELGYNCNRKYNDSCHDVFRARSAAFATMTWCALILAWEVID
MRRSFFRMQPETDSPFTQFFKDIWGNQFLFWSVIFGFGSAFPVIYIPVINTDVFLHKPIG
AEWGIAIAFSAAFWMGAELYKYIKRLYFKNKLKAVNPENDLEKKSNRDPFEAYSTSTTIQ
TDIYIPKKNSF
Download sequence
Identical sequences A7TM31
436907.A7TM31 XP_001644531.1.22633 tr|A7TM31|A7TM31_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]