SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TMA6|A7TMA6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TMA6|A7TMA6_VANPO
Domain Number 1 Region: 15-182
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.75e-69
Family Cyclophilin (peptidylprolyl isomerase) 0.000000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TMA6|A7TMA6_VANPO
Sequence length 184
Comment Peptidyl-prolyl cis-trans isomerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_520p21
Sequence
MFKRSVISQTRLFSSTSARFGSKVYFEPSINGEKVGRIEFNLYDEVVPKTANNFRALCTG
EKGFGYKGVPFHRIIPQFMIQGGDTDLAGGYGGKSIYGSKFPDENFEKVHDKSGLLSMAN
AGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKKIESLGDMSGAPKAKIVIEDAG
EIKD
Download sequence
Identical sequences A7TMA6
436907.A7TMA6 XP_001644458.1.22633 tr|A7TMA6|A7TMA6_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]