SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TMQ2|A7TMQ2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TMQ2|A7TMQ2_VANPO
Domain Number 1 Region: 252-412
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000467
Family Reverse transcriptase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TMQ2|A7TMQ2_VANPO
Sequence length 415
Comment Tkp1 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1066p33
Sequence
MIYSDNPLSFYYSDFNKPISSSTFDEELPPDVIPISDDSSTPSVIEDDVPPEIPSLSSST
PALPDELINSSPENSHSGGIIDDTTISSDTSPAISPSLENSPSGGTIADLNTSSANPVSP
SLLAQNSNSGGITQPSVSTDLGGIGKEQDSSKKRIREINENNDMKKQPYWRKNDLSSINF
PPRQKRRIHLINSVKHAINNPPSVGNNSLSYREAITLNQNPIDKDSYKKAYMKEVNQLMK
HETWDNHNLYDIQEVNPKTVINSMFIFITKRDGTHKCRFVAQGDQQKPGTYYDSLAANTI
HHEALMTCMAIALDNDMFIVQLDISSAYLYADLKEELYIRTPPHLGHKNKVFKLQKSLYG
LKQSGANWYENIKNYITETCGMSSIRGWSCAFKKDDLMVCLFVDNIIMFGKDHNE
Download sequence
Identical sequences A7TMQ2
436907.A7TMQ2 XP_001644324.1.22633 tr|A7TMQ2|A7TMQ2_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]