SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TMU8|A7TMU8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TMU8|A7TMU8_VANPO
Domain Number 1 Region: 462-557,681-778,1229-1441
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.05e-74
Family Calcium ATPase, transmembrane domain M 0.017
Further Details:      
 
Domain Number 2 Region: 779-795,986-1074,1143-1230
Classification Level Classification E-value
Superfamily HAD-like 4.99e-31
Family Meta-cation ATPase, catalytic domain P 0.0043
Further Details:      
 
Domain Number 3 Region: 556-683
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.32e-19
Family Calcium ATPase, transduction domain A 0.0018
Further Details:      
 
Domain Number 4 Region: 790-806,839-881,925-1037
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.71e-18
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TMU8|A7TMU8_VANPO
Sequence length 1469
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1030p30
Sequence
MVDPVYDNYEHSRNEPSNHRASFSSARTSSTATTLTSAIALNQNNNEAFDGAASETVPSS
IVSFHRPHSFQSSNILGTSLTSRNLERRGRASTETDSLVDSSGEPSRSSSRNPHFRFFTE
EQISNAEGSSTMENAEYNIEWDSMPVYEHNVLSNSRIGSRRSSFIGTSRSPSASQPIQYG
SFDEHRSSSLKPIRKDTVVPPSDHPHVYHSLSHSSSGLSRYAVRDRIPYELEMQEDELLD
TASSRSSLNVSTSDVLLDDENDRGSISEEDRNQQRKQISHAIYLNPQYHEKFYPNYIPIT
KYQRFYIAEEDLVIGIAGYKTSKFRLFIYNFFCIVTLGIFYLVMRWFPHYKVRFIGSKTE
LAKAEWTVIETENGELFVEPVKRTWYNRLFSTILPIEKSTWTNPDGTMNNSFSFNHASKK
NPNIPILITFEYRYINFIYSPVEDIFRTNNNWADPNWFDLESIQRGLSKGVQEDRFLAFG
KNQINLKGKTTLQILFNETLHPFYVFQIFSILLWSVDEYYYYAFCIFLISLISIIDSLLE
TKKTSKRLSELSAFSCEVRVFRDEFWTHINSSELVPGDVYEISDPALTVCPCDSILLNGD
CVVNESMLTGESVPISKMPATEETMHQLFNDMEKSQISSLVSKSFLFNGTKVIRARVPHG
QSAALAVVVRTGFSTVKGSLVRSMVFPKPTGFKFYQDSFKYIGFMTLIAMIGFTISCIQF
VRIGLDKKTMILRALDIITIVVPPALPATLTIGTSFSLSRLKEKGIFCISPTRVNVAGKV
DAMCFDKTGTLTEDELDVLGVHLVMTEERNRIVMGELINDIHNVFTNFSLKDCSSLDDFK
ARDFLISLLTCHSLRHVDGELLGDPLDFKMFKFTGWLFEEDFKDQAFHSLYEERHEENTF
PENSGIIPAVVYPDSSDPQNKFNEKDPNNLLGIVRSFEFLSELRRMSVIVKPNGENMYWS
FTKGAPEVITTLCNKSTIPCDFDELLHHYTHNGYRVIACAGKNLPKRTWLYSQRVSREEV
ETNLNFLGFIVFENKLKGATKGTLKSLAESNIRTIMCTGDNVLTAISIGKESGLVNSSRV
YVPSISEITDEGHGYISWNDIDDPTHTLDEISLKPNDSQVGDYTLGVTGEVFRLLFKNDT
DYSETYRNEVLLKTSIYARMSPDEKHELMEQLQSLDYVVGFCGDGANDCGALKSADIGIS
LSEAEASVAAPFTSRVFDISCVLDVIKEGRGALVTSFACFQYMSLYSAIQFITITILYSR
GSNLGDFQFLYIDLILIVPIAITMSWSKPYDKLVAKRPTANLVSPKILVPLVVSILICLL
FQIIPWIVVQRMPWYLKPVVGDDHTVISSDNTVLFFLSNFQYILVAVVLSVGPPYREPMS
KNFGFIMDIAISIIMSIFLMGIDPDSFFGRLLQLSKISETFKVFIALLAIVNYFTQLYIP
NHIKGYFKKKKSSKKYKNIIKTQNREYSV
Download sequence
Identical sequences A7TMU8
tr|A7TMU8|A7TMU8_VANPO 436907.A7TMU8 XP_001644278.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]