SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TMV6|A7TMV6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TMV6|A7TMV6_VANPO
Domain Number 1 Region: 27-492
Classification Level Classification E-value
Superfamily ADC synthase 2.75e-139
Family ADC synthase 0.00000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TMV6|A7TMV6_VANPO
Sequence length 508
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1030p38
Sequence
MASTIKVQPDLESLKQLYRENEGTPINMYPIYAFLPTLDLTPHAAYLKLAKLNDPNREPS
FLLESAKTSTELDRYSFIGISPRKIMKSGPTESIEADPLVLLEKEMEKTKLAENVPGLPP
LSGGAVGYISYDCVRYFEPKTIRPLKDVLQVPESYLMLCDTIIAFDHVYQRFQIIHNINI
NEIKLEEGYQKASDIINDIIKKLTDDSPIPYPHQDKITLGQTFTSNVGREGYEMHVSTLK
KHIKKGDIIQGVPSQRVARPTSLHPFNIYGHLRTVNPSPYLFYIDCLDFQIIGASPELLC
KSDSKNKVITHPIAGTVKRGKTAEEDDILADQLRGSLKDRAEHVMLVDLARNDINRVCDP
RTTSVDKLLTVQKFSHVQHLVSEVSGTLRPGKTRFDAFRSIFPAGTVSGAPKVKAMELIA
ELEGERRGIYAGAVGNWSYDGKTMDTCIALRTMVYKDGIAYLQAGGGIVYDSDEYDEYIE
TMNKMMANHNTIVQAEEIWAAKVGSNEI
Download sequence
Identical sequences A7TMV6
436907.A7TMV6 XP_001644286.1.22633 tr|A7TMV6|A7TMV6_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]