SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TN07|A7TN07_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TN07|A7TN07_VANPO
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000011
Family Reverse transcriptase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TN07|A7TN07_VANPO
Sequence length 303
Comment Tkp3 protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1059p3
Sequence
SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP
TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV
NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFTVDIPLSHLTLLSADSDVAP
SSTTNPEPSTEAPNSDNPTDPDYVIQNVNSLTLPQLLEIQQLLADKISSAPPIFSKIIDR
FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL
LLV
Download sequence
Identical sequences A7TN07
XP_001644171.1.22633 tr|A7TN07|A7TN07_VANPO 436907.A7TN07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]