SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TN19|A7TN19_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TN19|A7TN19_VANPO
Domain Number - Region: 110-185
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000938
Family Fibronectin type III 0.011
Further Details:      
 
Domain Number - Region: 282-384
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TN19|A7TN19_VANPO
Sequence length 897
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1059p15
Sequence
MGHFYLTLLAALWALHRIYIFLTIPVLKIVKYLNIKTPYATKVSIDKITTTSIAVHWENE
PREISINNSNTKIKLNSNNDNNDNNDNNDYTTKRKEKESSKDNTDQKCTDDSSISHYILY
LNGTQIAVFPNYPDSLYTCCSLNGLKSNTTYQLDFITVNNMGFINKLPSIHCMTRHEKND
VVKTPKSSWKRNSTPIGSSIVTENVSSYNTLTTLKDLEDYSIDDLKKILICAQEDLHYVT
SQRSIILNDFKDSKLQLKLELENLKNNWHHENELHKSLRSNIKTLENSKALYDLKLGKLN
KKIEQCKTKLNKMENELKNWLNQDTMLEVLEENYDSKTANIKKEKERLSSDIILLQEEVS
RKELINKELNTNKSNIEVKTDTSKLITEINDSINDETGLLDNAGSSVLTKLSTSSTFYNL
ITDHLNIDSKLNSSWNREKKSYMKRIASLEEMFNQLSLQNSQLRANMIIQPYSNVEAQSL
SNHGSGTALNELTGMTSPIPNSGSFIDMISLNERSSTIGNNSTKDNGTRQFVPAATSPNI
GGPENENNSKKAINDQINNISINNKHEPQSEILGRNRAVFIFDEEQTQHADPNQIQQRKS
PNLATQMNIINNQFTHSYPTTATVTTNATASATPNLNLHFPWTESNSEKKEAQLANNEDF
YQQFNYDNADHVISGLQDMIFEESDDVDHISNYSKGFTTDQLDNYWTTKSMTTDSNRLSV
QDKISPTSPQAVLAFSNKNDFISPISTGSLPFNSYLTNISSGPDSSQQPFTSSYNDNIIG
SFPESVSMRNSNSFNYFSNEPTSAHSSATMIPDDNRLHILSGFRDNSSSANNSSNNQSIN
TIETHGKNSHFSNFLWNTSAASDSPNDSKDTDKTPTTSPSKRKWFSKKPRKKSITSQ
Download sequence
Identical sequences A7TN19
XP_001644183.1.22633 436907.A7TN19 tr|A7TN19|A7TN19_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]